Recombinant Human CA13 Protein

Cat.No. : CA13-806H
Product Overview : Recombinant Human CA13 was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Carbonic anhydrases (CAs) are enzymes which catalyze the reversible hydration of carbon dioxide according to the following reaction: CO2 + H2O ↔ HCO3- + H+. The main function of this protein family is to regulate the acid-base balance, which is of a considerable biological importance. In addition, they participate in several other physiological functions including CO2 and HCO3- transport, bone resorption, production of biological fluids, ureagenesis, gluconeogenesis and lipogenesis. Carbonic anhydrases are metalloenzymes containing a zinc-atom in their active site. The expanding CA gene family includes at least 13 enzymatically active members with different structural and catalytic properties.
Form : PBS and 0.05 M NaN3
Molecular Mass : 29 kDa
Purity : > 95 % (SDS-PAGE under reducing conditions)
Storage : Store at -80 centigrade, avoid freeze/thaw cycles.
AA Sequence : RGSMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Gene Name CA13 carbonic anhydrase XIII [ Homo sapiens ]
Official Symbol CA13
Synonyms CAXIII
Gene ID 377677
mRNA Refseq NM_198584.2
Protein Refseq NP_940986.1
MIM 611436
UniProt ID Q8N1Q1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CA13 Products

Required fields are marked with *

My Review for All CA13 Products

Required fields are marked with *

0
cart-icon
0
compare icon