Recombinant Human CA13 Protein

• Cat.No.: CA13-806H
• Product Overview: Recombinant Human CA13 was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Carbonic anhydrases (CAs) are enzymes which catalyze the reversible hydration of carbon dioxide according to the following reaction: CO2 + H2O ↔ HCO3- + H+. The main function of this protein family is to regulate the acid-base balance, which is of a considerable biological importance. In addition, they participate in several other physiological functions including CO2 and HCO3- transport, bone resorption, production of biological fluids, ureagenesis, gluconeogenesis and lipogenesis. Carbonic anhydrases are metalloenzymes containing a zinc-atom in their active site. The expanding CA gene family includes at least 13 enzymatically active members with different structural and catalytic properties.
• Form: PBS and 0.05 M NaN3
• Molecular Mass: 29 kDa
• Purity: > 95 % (SDS-PAGE under reducing conditions)
• Storage: Store at -80 centigrade, avoid freeze/thaw cycles.
• AA Sequence: RGSMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

Gene Information

• Gene Name: CA13 carbonic anhydrase XIII [ Homo sapiens ]
• Official Symbol: CA13
• Synonyms: CAXIII
• Gene ID: 377677
• mRNA Refseq: NM_198584.2
• Protein Refseq: NP_940986.1
• MIM: 611436
• UniProt ID: Q8N1Q1