Recombinant Human CA2 protein, His-SUMO-tagged
Cat.No. : | CA2-2617H |
Product Overview : | Recombinant Human CA2 protein(P00918)(2-260aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-260aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.1 kDa |
AA Sequence : | SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CA2 carbonic anhydrase II [ Homo sapiens ] |
Official Symbol | CA2 |
Synonyms | CA2; carbonic anhydrase II; carbonic anhydrase 2; CA II; CAII; Car2; CAC; carbonic anhydrase B; carbonic anhydrase C; carbonic dehydratase; carbonate dehydratase II; CA-II; |
Gene ID | 760 |
mRNA Refseq | NM_000067 |
Protein Refseq | NP_000058 |
MIM | 611492 |
UniProt ID | P00918 |
◆ Recombinant Proteins | ||
CAR2-2718M | Recombinant Mouse CAR2 Protein | +Inquiry |
RFL11115CF | Recombinant Full Length Capsicum Annuum Beta-Carotene Hydroxylase 2, Chloroplastic(Ca2) Protein, His-Tagged | +Inquiry |
Ca2-543R | Recombinant Rat Ca2 protein, His-tagged | +Inquiry |
CA2-1114H | Active Recombinant Human CA2 protein, His-tagged | +Inquiry |
CA2-354H | Recombinant Human CA2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA2-7915HCL | Recombinant Human CA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA2 Products
Required fields are marked with *
My Review for All CA2 Products
Required fields are marked with *
0
Inquiry Basket