Recombinant Human CA2 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CA2-201H |
Product Overview : | CA2 MS Standard C13 and N15-labeled recombinant protein (NP_000058) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014] |
Molecular Mass : | 29.2 kDa |
AA Sequence : | MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CA2 carbonic anhydrase II [ Homo sapiens (human) ] |
Official Symbol | CA2 |
Synonyms | CA2; carbonic anhydrase II; carbonic anhydrase 2; CA II; CAII; Car2; CAC; carbonic anhydrase B; carbonic anhydrase C; carbonic dehydratase; carbonate dehydratase II; CA-II; |
Gene ID | 760 |
mRNA Refseq | NM_000067 |
Protein Refseq | NP_000058 |
MIM | 611492 |
UniProt ID | P00918 |
◆ Recombinant Proteins | ||
CA2-425R | Recombinant Rhesus Macaque CA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CA2-2060HFL | Recombinant Full Length Human CA2 Protein, C-Flag-tagged | +Inquiry |
CA2-2734HF | Recombinant Full Length Human CA2 Protein, GST-tagged | +Inquiry |
CA2-0615H | Recombinant Human CA2 Protein (Met1-Lys260), N-His-tagged | +Inquiry |
CA2-10619H | Recombinant Human CA2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA2-7915HCL | Recombinant Human CA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA2 Products
Required fields are marked with *
My Review for All CA2 Products
Required fields are marked with *