Recombinant Human CA2 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : CA2-201H
Product Overview : CA2 MS Standard C13 and N15-labeled recombinant protein (NP_000058) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]
Molecular Mass : 29.2 kDa
AA Sequence : MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CA2 carbonic anhydrase II [ Homo sapiens (human) ]
Official Symbol CA2
Synonyms CA2; carbonic anhydrase II; carbonic anhydrase 2; CA II; CAII; Car2; CAC; carbonic anhydrase B; carbonic anhydrase C; carbonic dehydratase; carbonate dehydratase II; CA-II;
Gene ID 760
mRNA Refseq NM_000067
Protein Refseq NP_000058
MIM 611492
UniProt ID P00918

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CA2 Products

Required fields are marked with *

My Review for All CA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon