Recombinant Human CA4 Protein, GST-Tagged
Cat.No. : | CA4-0240H |
Product Overview : | Human CA4 full-length ORF (AAH57792, 19 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Its exact function is not known; however, it may have a role in inherited renal abnormalities of bicarbonate transport. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 58.08 kDa |
AA Sequence : | AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CA4 carbonic anhydrase IV [ Homo sapiens ] |
Official Symbol | CA4 |
Synonyms | CA4; carbonic anhydrase IV; retinitis pigmentosa 17 (autosomal dominant), RP17; carbonic anhydrase 4; CAIV; Car4; CA-IV; carbonic dehydratase IV; carbonate dehydratase IV; RP17; |
Gene ID | 762 |
mRNA Refseq | NM_000717 |
Protein Refseq | NP_000708 |
MIM | 114760 |
UniProt ID | P22748 |
◆ Recombinant Proteins | ||
CA4-10621H | Recombinant Human CA4, GST-tagged | +Inquiry |
CA4-115H | Recombinant Human CA4 Protein, His-tagged | +Inquiry |
Car4-263M | Recombinant Mouse Carbonic Anhydrase 4, His-tagged | +Inquiry |
CA4-0843H | Recombinant Human CA4 Protein (Ala19-Lys283), C-His tagged | +Inquiry |
CA4-2271H | Recombinant Human CA4 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA4-2069HCL | Recombinant Human CA4 cell lysate | +Inquiry |
CA4-2501MCL | Recombinant Mouse CA4 cell lysate | +Inquiry |
CA4-001HCL | Recombinant Human CA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA4 Products
Required fields are marked with *
My Review for All CA4 Products
Required fields are marked with *