Recombinant Human CA4 Protein, His-tagged
Cat.No. : | CA4-115H |
Product Overview : | Recombinant human CA4 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 312 |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Its exact function is not known; however, it may have a role in inherited renal abnormalities of bicarbonate transport. |
Form : | Lyophilized |
Molecular Mass : | 31 kDa |
AA Sequence : | MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CA4 carbonic anhydrase IV [ Homo sapiens (human) ] |
Official Symbol | CA4 |
Synonyms | CA4; carbonic anhydrase IV; retinitis pigmentosa 17 (autosomal dominant) , RP17; carbonic anhydrase 4; CAIV; Car4; CA-IV; carbonic dehydratase IV; carbonate dehydratase IV; RP17; |
Gene ID | 762 |
mRNA Refseq | NM_000717 |
Protein Refseq | NP_000708 |
MIM | 114760 |
UniProt ID | P22748 |
◆ Recombinant Proteins | ||
Car4-7836M | Recombinant Mouse Car4 protein, His-tagged | +Inquiry |
Car4-364R | Recombinant Rat Car4 Protein, His-tagged | +Inquiry |
CA4-10621H | Recombinant Human CA4, GST-tagged | +Inquiry |
CAR4-1133R | Recombinant Rat CAR4 Protein | +Inquiry |
Car4-263M | Recombinant Mouse Carbonic Anhydrase 4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA4-2069HCL | Recombinant Human CA4 cell lysate | +Inquiry |
CA4-001HCL | Recombinant Human CA4 cell lysate | +Inquiry |
CA4-2501MCL | Recombinant Mouse CA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA4 Products
Required fields are marked with *
My Review for All CA4 Products
Required fields are marked with *
0
Inquiry Basket