Active Recombinant Human CA4 Protein, His tagged

• Cat.No.: CA4-115H
• Product Overview: Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293, with C-His tag.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 19-283 aa
• Description: Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH.
• Form: Lyophilized powder, Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
• Bio-activity: Measured by its esterase activity and the specific activity is > 2 pmoles/min/μg at room temperature for 60 minutes in the dark.
• Molecular Mass: Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
• AASequence: MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
• Endotoxin: < 1 EU/μg by LAL
• Storage: Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage.
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Gene Information

• Gene Name: CA4 carbonic anhydrase IV [ Homo sapiens (human) ]
• Official Symbol: CA4
• Synonyms: CA4; carbonic anhydrase IV; retinitis pigmentosa 17 (autosomal dominant), RP17; carbonic anhydrase 4; CAIV; Car4; CA-IV; carbonic dehydratase IV; carbonate dehydratase IV; RP17
• Gene ID: 762
• mRNA Refseq: NM_000717
• Protein Refseq: NP_000708
• MIM: 114760
• UniProt ID: P22748