Active Recombinant Human CA4 Protein, His tagged
| Cat.No. : | CA4-115H |
| Product Overview : | Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293, with C-His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 19-283 aa |
| Description : | Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. |
| Form : | Lyophilized powder, Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose. |
| Bio-activity : | Measured by its esterase activity and the specific activity is > 2 pmoles/min/μg at room temperature for 60 minutes in the dark. |
| Molecular Mass : | Approximately 33 kDa, based on SDS-PAGE under reducing conditions. |
| AASequence : | MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK |
| Endotoxin : | < 1 EU/μg by LAL |
| Storage : | Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage. |
| Reconstitution : | It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. |
| Gene Name | CA4 carbonic anhydrase IV [ Homo sapiens (human) ] |
| Official Symbol | CA4 |
| Synonyms | CA4; carbonic anhydrase IV; retinitis pigmentosa 17 (autosomal dominant), RP17; carbonic anhydrase 4; CAIV; Car4; CA-IV; carbonic dehydratase IV; carbonate dehydratase IV; RP17 |
| Gene ID | 762 |
| mRNA Refseq | NM_000717 |
| Protein Refseq | NP_000708 |
| MIM | 114760 |
| UniProt ID | P22748 |
| ◆ Recombinant Proteins | ||
| CA4-0240H | Recombinant Human CA4 Protein, GST-Tagged | +Inquiry |
| CA4-2739HF | Recombinant Full Length Human CA4 Protein, GST-tagged | +Inquiry |
| CA4-115H | Active Recombinant Human CA4 Protein, His tagged | +Inquiry |
| Car4-263M | Recombinant Mouse Carbonic Anhydrase 4, His-tagged | +Inquiry |
| CA4-237HB | Recombinant Human CA4 Protein(Met1-Lys283), His-tagged, Amine-Labeled Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CA4-001HCL | Recombinant Human CA4 cell lysate | +Inquiry |
| CA4-2501MCL | Recombinant Mouse CA4 cell lysate | +Inquiry |
| CA4-2069HCL | Recombinant Human CA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA4 Products
Required fields are marked with *
My Review for All CA4 Products
Required fields are marked with *
