Recombinant Human CACNA1A protein, GST-tagged
Cat.No. : | CACNA1A-301352H |
Product Overview : | Recombinant Human CACNA1A (821-920 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met821-Glu920 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CACNA1A calcium channel, voltage-dependent, P/Q type, alpha 1A subunit [ Homo sapiens ] |
Official Symbol | CACNA1A |
Synonyms | CACNA1A; calcium channel, voltage-dependent, P/Q type, alpha 1A subunit; CACNL1A4, MHP, MHP1, SCA6; voltage-dependent P/Q-type calcium channel subunit alpha-1A; APCA; Cav2.1; EA2; FHM; HPCA; brain calcium channel 1; brain calcium channel I; calcium channel, L type, alpha-1 polypeptide; voltage-gated calcium channel subunit alpha Cav2.1; BI; MHP; MHP1; SCA6; CAV2.1; CACNL1A4; |
Gene ID | 773 |
mRNA Refseq | NM_000068 |
Protein Refseq | NP_000059 |
MIM | 601011 |
UniProt ID | O00555 |
◆ Recombinant Proteins | ||
CACNA1A-301352H | Recombinant Human CACNA1A protein, GST-tagged | +Inquiry |
CACNA1A-301353H | Recombinant Human CACNA1A protein, His-tagged | +Inquiry |
CACNA1A-301354H | Recombinant Human CACNA1A protein, His-tagged | +Inquiry |
RFL19551GF | Recombinant Full Length Chicken Voltage-Dependent P/Q-Type Calcium Channel Subunit Alpha-1A(Cacna1A) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CACNA1A Products
Required fields are marked with *
My Review for All CACNA1A Products
Required fields are marked with *
0
Inquiry Basket