Recombinant Human CACNA1E protein, GST-tagged
Cat.No. : | CACNA1E-1875H |
Product Overview : | Recombinant Human CACNA1E protein(801-900 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 801-900 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CACNA1E calcium channel, voltage-dependent, R type, alpha 1E subunit [ Homo sapiens ] |
Official Symbol | CACNA1E |
Synonyms | CACNA1E; calcium channel, voltage-dependent, R type, alpha 1E subunit; CACNL1A6; voltage-dependent R-type calcium channel subunit alpha-1E; BII; CACH6; Cav2.3; brain calcium channel II; voltage-gated calcium channel alpha 1E subunit; voltage-dependent calcium channel alpha 1E subunit; voltage-gated calcium channel alpha subunit Cav2.3; voltage-gated calcium channel subunit alpha Cav2.3; calcium channel, voltage-dependent, alpha 1E subunit; calcium channel, L type, alpha-1 polypeptide, isoform 6; calcium channel, R type, alpha-1 polypeptide, isoform 6; |
Gene ID | 777 |
mRNA Refseq | NM_000721 |
Protein Refseq | NP_000712 |
MIM | 601013 |
UniProt ID | Q15878 |
◆ Recombinant Proteins | ||
CACNA1E-0265H | Recombinant Human CACNA1E Protein, GST-Tagged | +Inquiry |
CACNA1E-1876H | Recombinant Human CACNA1E protein, His-tagged | +Inquiry |
CACNA1E-1875H | Recombinant Human CACNA1E protein, GST-tagged | +Inquiry |
Cacna1e-353M | Recombinant Mouse Cacna1e Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CACNA1E Products
Required fields are marked with *
My Review for All CACNA1E Products
Required fields are marked with *
0
Inquiry Basket