Recombinant Human CACNA1E protein, GST-tagged

• Cat.No.: CACNA1E-1875H
• Product Overview: Recombinant Human CACNA1E protein(801-900 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 801-900 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CACNA1E calcium channel, voltage-dependent, R type, alpha 1E subunit [ Homo sapiens ]
• Official Symbol: CACNA1E
• Synonyms: CACNA1E; calcium channel, voltage-dependent, R type, alpha 1E subunit; CACNL1A6; voltage-dependent R-type calcium channel subunit alpha-1E; BII; CACH6; Cav2.3; brain calcium channel II; voltage-gated calcium channel alpha 1E subunit; voltage-dependent calcium channel alpha 1E subunit; voltage-gated calcium channel alpha subunit Cav2.3; voltage-gated calcium channel subunit alpha Cav2.3; calcium channel, voltage-dependent, alpha 1E subunit; calcium channel, L type, alpha-1 polypeptide, isoform 6; calcium channel, R type, alpha-1 polypeptide, isoform 6
• Gene ID: 777
• mRNA Refseq: NM_000721
• Protein Refseq: NP_000712
• MIM: 601013
• UniProt ID: Q15878