Recombinant Human CACNA1E protein, GST-tagged

Cat.No. : CACNA1E-1875H
Product Overview : Recombinant Human CACNA1E protein(801-900 aa), fused to GST tag, was expressed in E. coli.
Availability June 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 801-900 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CACNA1E calcium channel, voltage-dependent, R type, alpha 1E subunit [ Homo sapiens ]
Official Symbol CACNA1E
Synonyms CACNA1E; calcium channel, voltage-dependent, R type, alpha 1E subunit; CACNL1A6; voltage-dependent R-type calcium channel subunit alpha-1E; BII; CACH6; Cav2.3; brain calcium channel II; voltage-gated calcium channel alpha 1E subunit; voltage-dependent calcium channel alpha 1E subunit; voltage-gated calcium channel alpha subunit Cav2.3; voltage-gated calcium channel subunit alpha Cav2.3; calcium channel, voltage-dependent, alpha 1E subunit; calcium channel, L type, alpha-1 polypeptide, isoform 6; calcium channel, R type, alpha-1 polypeptide, isoform 6;
Gene ID 777
mRNA Refseq NM_000721
Protein Refseq NP_000712
MIM 601013
UniProt ID Q15878

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNA1E Products

Required fields are marked with *

My Review for All CACNA1E Products

Required fields are marked with *

0
cart-icon