Recombinant Human CACNA1F Protein, GST-Tagged
Cat.No. : | CACNA1F-0266H |
Product Overview : | Human CACNA1F partial ORF (NP_005174, 1878 a.a. - 1977 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a multipass transmembrane protein that functions as an alpha-1 subunit of the voltage-dependent calcium channel, which mediates the influx of calcium ions into the cell. The encoded protein forms a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Mutations in this gene can cause X-linked eye disorders, including congenital stationary night blindness type 2A, cone-rod dystropy, and Aland Island eye disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Aug 2013] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CACNA1F calcium channel, voltage-dependent, L type, alpha 1F subunit [ Homo sapiens ] |
Official Symbol | CACNA1F |
Synonyms | CACNA1F; calcium channel, voltage-dependent, L type, alpha 1F subunit; AIED, Aland island eye disease (Forsius Eriksson ocular albinism, ocular albinism type 2), CSNB2; voltage-dependent L-type calcium channel subunit alpha-1F; Cav1.4; COD4; CORDX3; CSNB2A; CSNBX2; JM8; JMC8; OA2; Cav1.4alpha1; voltage gated calcium channel alpha 1F subunit; voltage-gated calcium channel subunit alpha Cav1.4; Aland island eye disease (Forsius-Eriksson ocular albinism, ocular albinism type 2); AIED; COD3; CORDX; CSNB2; |
Gene ID | 778 |
mRNA Refseq | NM_001256789 |
Protein Refseq | NP_001243718 |
MIM | 300110 |
UniProt ID | O60840 |
◆ Recombinant Proteins | ||
CACNA1F-0266H | Recombinant Human CACNA1F Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA1F Products
Required fields are marked with *
My Review for All CACNA1F Products
Required fields are marked with *