Recombinant Human CACNA1F Protein, GST-Tagged

Cat.No. : CACNA1F-0266H
Product Overview : Human CACNA1F partial ORF (NP_005174, 1878 a.a. - 1977 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a multipass transmembrane protein that functions as an alpha-1 subunit of the voltage-dependent calcium channel, which mediates the influx of calcium ions into the cell. The encoded protein forms a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Mutations in this gene can cause X-linked eye disorders, including congenital stationary night blindness type 2A, cone-rod dystropy, and Aland Island eye disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Aug 2013]
Molecular Mass : 36.74 kDa
AA Sequence : LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CACNA1F calcium channel, voltage-dependent, L type, alpha 1F subunit [ Homo sapiens ]
Official Symbol CACNA1F
Synonyms CACNA1F; calcium channel, voltage-dependent, L type, alpha 1F subunit; AIED, Aland island eye disease (Forsius Eriksson ocular albinism, ocular albinism type 2), CSNB2; voltage-dependent L-type calcium channel subunit alpha-1F; Cav1.4; COD4; CORDX3; CSNB2A; CSNBX2; JM8; JMC8; OA2; Cav1.4alpha1; voltage gated calcium channel alpha 1F subunit; voltage-gated calcium channel subunit alpha Cav1.4; Aland island eye disease (Forsius-Eriksson ocular albinism, ocular albinism type 2); AIED; COD3; CORDX; CSNB2;
Gene ID 778
mRNA Refseq NM_001256789
Protein Refseq NP_001243718
MIM 300110
UniProt ID O60840

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNA1F Products

Required fields are marked with *

My Review for All CACNA1F Products

Required fields are marked with *

0
cart-icon
0
compare icon