Recombinant Human CACNA1S protein, His-tagged

Cat.No. : CACNA1S-119H
Product Overview : Recombinant Human CACNA1S protein(Q13698)(Pro1511-Asn1660), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Pro1511-Asn1660
Tag : C-His
Form : Phosphate buffered saline.
Molecular Mass : 19 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDIVQIQAGLRTIEEEAAPEICRTVSGDLAAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPPVMANQRPLQFAEIEMEEMESPVFLEDFPQDPRTNPLARAN
Gene Name CACNA1S calcium channel, voltage-dependent, L type, alpha 1S subunit [ Homo sapiens ]
Official Symbol CACNA1S
Synonyms CACNA1S; calcium channel, voltage-dependent, L type, alpha 1S subunit; CACNL1A3, HOKPP, MHS5; voltage-dependent L-type calcium channel subunit alpha-1S; Cav1.1; hypoPP; dihydropyridine receptor; voltage-gated calcium channel subunit alpha Cav1.1; dihydropyridine-sensitive L-type calcium channel alpha-1 subunit; calcium channel, L type, alpha 1 polypeptide, isoform 3 (skeletal muscle, hypokalemic periodic paralysis); MHS5; HOKPP; TTPP1; HOKPP1; CCHL1A3; CACNL1A3;
Gene ID 779
mRNA Refseq NM_000069
Protein Refseq NP_000060
MIM 114208
UniProt ID Q13698

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNA1S Products

Required fields are marked with *

My Review for All CACNA1S Products

Required fields are marked with *

0
cart-icon
0
compare icon