Recombinant Human CACNA1S protein, His-tagged

• Cat.No.: CACNA1S-119H
• Product Overview: Recombinant Human CACNA1S protein(Q13698)(Pro1511-Asn1660), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Pro1511-Asn1660
• Tag: C-His
• Form: Phosphate buffered saline.
• Molecular Mass: 19 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDIVQIQAGLRTIEEEAAPEICRTVSGDLAAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPPVMANQRPLQFAEIEMEEMESPVFLEDFPQDPRTNPLARAN

Gene Information

• Gene Name: CACNA1S calcium channel, voltage-dependent, L type, alpha 1S subunit [ Homo sapiens ]
• Official Symbol: CACNA1S
• Synonyms: CACNA1S; calcium channel, voltage-dependent, L type, alpha 1S subunit; CACNL1A3, HOKPP, MHS5; voltage-dependent L-type calcium channel subunit alpha-1S; Cav1.1; hypoPP; dihydropyridine receptor; voltage-gated calcium channel subunit alpha Cav1.1; dihydropyridine-sensitive L-type calcium channel alpha-1 subunit; calcium channel, L type, alpha 1 polypeptide, isoform 3 (skeletal muscle, hypokalemic periodic paralysis); MHS5; HOKPP; TTPP1; HOKPP1; CCHL1A3; CACNL1A3
• Gene ID: 779
• mRNA Refseq: NM_000069
• Protein Refseq: NP_000060
• MIM: 114208
• UniProt ID: Q13698