Recombinant Human CACNA1S protein, His-tagged
| Cat.No. : | CACNA1S-119H |
| Product Overview : | Recombinant Human CACNA1S protein(Q13698)(Pro1511-Asn1660), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Pro1511-Asn1660 |
| Tag : | C-His |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 19 kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | PPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDIVQIQAGLRTIEEEAAPEICRTVSGDLAAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPPVMANQRPLQFAEIEMEEMESPVFLEDFPQDPRTNPLARAN |
| Gene Name | CACNA1S calcium channel, voltage-dependent, L type, alpha 1S subunit [ Homo sapiens ] |
| Official Symbol | CACNA1S |
| Synonyms | CACNA1S; calcium channel, voltage-dependent, L type, alpha 1S subunit; CACNL1A3, HOKPP, MHS5; voltage-dependent L-type calcium channel subunit alpha-1S; Cav1.1; hypoPP; dihydropyridine receptor; voltage-gated calcium channel subunit alpha Cav1.1; dihydropyridine-sensitive L-type calcium channel alpha-1 subunit; calcium channel, L type, alpha 1 polypeptide, isoform 3 (skeletal muscle, hypokalemic periodic paralysis); MHS5; HOKPP; TTPP1; HOKPP1; CCHL1A3; CACNL1A3; |
| Gene ID | 779 |
| mRNA Refseq | NM_000069 |
| Protein Refseq | NP_000060 |
| MIM | 114208 |
| UniProt ID | Q13698 |
| ◆ Recombinant Proteins | ||
| CACNA1S-0268H | Recombinant Human CACNA1S Protein, GST-Tagged | +Inquiry |
| CACNA1S-1715H | Recombinant Human CACNA1S protein, His & T7-tagged | +Inquiry |
| Cacna1s-1716R | Recombinant Rat Cacna1s protein, His & T7-tagged | +Inquiry |
| Cacna1s-1422M | Recombinant Mouse Cacna1s protein, His & T7-tagged | +Inquiry |
| CACNA1S-0614H | Recombinant Human CACNA1S Protein (Ala1657-Leu1873), N-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA1S Products
Required fields are marked with *
My Review for All CACNA1S Products
Required fields are marked with *
