Recombinant Human CACNA2D1 protein, His-SUMO-tagged

Cat.No. : CACNA2D1-2619H
Product Overview : Recombinant Human CACNA2D1 protein(P54289)(577-717aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 577-717aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.3 kDa
AA Sequence : KMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQ
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CACNA2D1 calcium channel, voltage-dependent, alpha 2/delta subunit 1 [ Homo sapiens ]
Official Symbol CACNA2D1
Synonyms CACNA2D1; calcium channel, voltage-dependent, alpha 2/delta subunit 1; CACNA2, CACNL2A, MHS3; voltage-dependent calcium channel subunit alpha-2/delta-1; calcium channel, L type, alpha 2 polypeptide; voltage-gated calcium channel subunit alpha-2/delta-1; dihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit; CACNA2; CCHL2A; CACNL2A;
Gene ID 781
mRNA Refseq NM_000722
Protein Refseq NP_000713
MIM 114204
UniProt ID P54289

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNA2D1 Products

Required fields are marked with *

My Review for All CACNA2D1 Products

Required fields are marked with *

0
cart-icon