Recombinant Human CACNB2
Cat.No. : | CACNB2-26766TH |
Product Overview : | Recombinant fragment of Human CACNB2 with N terminal proprietary tag, 35.42kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 89 amino acids |
Description : | This gene encodes a subunit of a voltage-dependent calcium channel protein which is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome which is an autoimmune disorder. Mutations in this gene are associated with Brugada symdrome. Alternatively spliced variants have been identified for this gene. |
Molecular Weight : | 35.420kDa inclusive of tags |
Tissue specificity : | Expressed in all tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ |
Sequence Similarities : | Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain. |
Gene Name | CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ] |
Official Symbol | CACNB2 |
Synonyms | CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2; |
Gene ID | 783 |
mRNA Refseq | NM_000724 |
Protein Refseq | NP_000715 |
MIM | 600003 |
Uniprot ID | Q08289 |
Chromosome Location | 10p12 |
Pathway | Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; |
Function | calcium channel activity; calcium channel regulator activity; protein binding; voltage-gated calcium channel activity; voltage-gated ion channel activity; |
◆ Recombinant Proteins | ||
CACNB2-0272H | Recombinant Human CACNB2 Protein, GST-Tagged | +Inquiry |
CACNB2-7856H | Recombinant Human CACNB2 protein, His-tagged | +Inquiry |
CACNB2-733R | Recombinant Rat CACNB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNB2-13HFL | Recombinant Full Length Human CACNB2 Protein, His-tagged | +Inquiry |
CACNB2-7855H | Recombinant Human CACNB2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNB2 Products
Required fields are marked with *
My Review for All CACNB2 Products
Required fields are marked with *