Recombinant Human CACNB2

• Cat.No.: CACNB2-26766TH
• Product Overview: Recombinant fragment of Human CACNB2 with N terminal proprietary tag, 35.42kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 89 amino acids
• Description: This gene encodes a subunit of a voltage-dependent calcium channel protein which is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome which is an autoimmune disorder. Mutations in this gene are associated with Brugada symdrome. Alternatively spliced variants have been identified for this gene.
• Molecular Weight: 35.420kDa inclusive of tags
• Tissue specificity: Expressed in all tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
• Sequence Similarities: Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain.

Gene Information

• Gene Name: CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ]
• Official Symbol: CACNB2
• Synonyms: CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2
• Gene ID: 783
• mRNA Refseq: NM_000724
• Protein Refseq: NP_000715
• MIM: 600003
• Uniprot ID: Q08289
• Chromosome Location: 10p12
• Pathway: Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem
• Function: calcium channel activity; calcium channel regulator activity; protein binding; voltage-gated calcium channel activity; voltage-gated ion channel activity