Recombinant Human CACNB2

Cat.No. : CACNB2-26766TH
Product Overview : Recombinant fragment of Human CACNB2 with N terminal proprietary tag, 35.42kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 89 amino acids
Description : This gene encodes a subunit of a voltage-dependent calcium channel protein which is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome which is an autoimmune disorder. Mutations in this gene are associated with Brugada symdrome. Alternatively spliced variants have been identified for this gene.
Molecular Weight : 35.420kDa inclusive of tags
Tissue specificity : Expressed in all tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
Sequence Similarities : Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain.
Gene Name CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ]
Official Symbol CACNB2
Synonyms CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2;
Gene ID 783
mRNA Refseq NM_000724
Protein Refseq NP_000715
MIM 600003
Uniprot ID Q08289
Chromosome Location 10p12
Pathway Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem;
Function calcium channel activity; calcium channel regulator activity; protein binding; voltage-gated calcium channel activity; voltage-gated ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNB2 Products

Required fields are marked with *

My Review for All CACNB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon