Recombinant Human CACNB2 protein, GST-tagged

• Cat.No.: CACNB2-7855H
• Product Overview: Recombinant Human CACNB2 protein(477-660 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 477-660 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: SRTLATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ]
• Official Symbol: CACNB2
• Synonyms: CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2; CAB2; lambert-Eaton myasthenic syndrome antigen B; myasthenic (Lambert-Eaton) syndrome antigen B; calcium channel voltage-dependent subunit beta 2; MYSB; CAVB2; CACNLB2; FLJ23743
• Gene ID: 783
• mRNA Refseq: NM_000724
• Protein Refseq: NP_000715
• MIM: 600003
• UniProt ID: Q08289