Recombinant Human CACNB2 protein, GST-tagged
Cat.No. : | CACNB2-7855H |
Product Overview : | Recombinant Human CACNB2 protein(477-660 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 477-660 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | SRTLATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ] |
Official Symbol | CACNB2 |
Synonyms | CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2; CAB2; lambert-Eaton myasthenic syndrome antigen B; myasthenic (Lambert-Eaton) syndrome antigen B; calcium channel voltage-dependent subunit beta 2; MYSB; CAVB2; CACNLB2; FLJ23743; |
Gene ID | 783 |
mRNA Refseq | NM_000724 |
Protein Refseq | NP_000715 |
MIM | 600003 |
UniProt ID | Q08289 |
◆ Recombinant Proteins | ||
CACNB2-26766TH | Recombinant Human CACNB2 | +Inquiry |
CACNB2-601R | Recombinant Rhesus monkey CACNB2 Protein, His-tagged | +Inquiry |
CACNB2-10639H | Recombinant Human CACNB2, His-tagged | +Inquiry |
CACNB2-0272H | Recombinant Human CACNB2 Protein, GST-Tagged | +Inquiry |
CACNB2-1069R | Recombinant Rat CACNB2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNB2 Products
Required fields are marked with *
My Review for All CACNB2 Products
Required fields are marked with *