Recombinant Human CACNB2 Protein, GST-Tagged

Cat.No. : CACNB2-0272H
Product Overview : Human CACNB2 partial ORF (NP_963890, 213 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a subunit of a voltage-dependent calcium channel protein that is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome, an autoimmune disorder. Mutations in this gene are associated with Brugada syndrome. Alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Feb 2013]
Molecular Mass : 35.53 kDa
AA Sequence : PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ]
Official Symbol CACNB2
Synonyms CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2; CAB2; lambert-Eaton myasthenic syndrome antigen B; myasthenic (Lambert-Eaton) syndrome antigen B; calcium channel voltage-dependent subunit beta 2; MYSB; CAVB2; CACNLB2; FLJ23743;
Gene ID 783
mRNA Refseq NM_000724
Protein Refseq NP_000715
MIM 600003
UniProt ID Q08289

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNB2 Products

Required fields are marked with *

My Review for All CACNB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon