Recombinant Human CACNB2 Protein, GST-Tagged

• Cat.No.: CACNB2-0272H
• Product Overview: Human CACNB2 partial ORF (NP_963890, 213 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a subunit of a voltage-dependent calcium channel protein that is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome, an autoimmune disorder. Mutations in this gene are associated with Brugada syndrome. Alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Feb 2013]
• Molecular Mass: 35.53 kDa
• AA Sequence: PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ]
• Official Symbol: CACNB2
• Synonyms: CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2; CAB2; lambert-Eaton myasthenic syndrome antigen B; myasthenic (Lambert-Eaton) syndrome antigen B; calcium channel voltage-dependent subunit beta 2; MYSB; CAVB2; CACNLB2; FLJ23743
• Gene ID: 783
• mRNA Refseq: NM_000724
• Protein Refseq: NP_000715
• MIM: 600003
• UniProt ID: Q08289