Recombinant Human CACNB2 Protein, GST-Tagged
Cat.No. : | CACNB2-0272H |
Product Overview : | Human CACNB2 partial ORF (NP_963890, 213 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of a voltage-dependent calcium channel protein that is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome, an autoimmune disorder. Mutations in this gene are associated with Brugada syndrome. Alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Feb 2013] |
Molecular Mass : | 35.53 kDa |
AA Sequence : | PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ] |
Official Symbol | CACNB2 |
Synonyms | CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2; CAB2; lambert-Eaton myasthenic syndrome antigen B; myasthenic (Lambert-Eaton) syndrome antigen B; calcium channel voltage-dependent subunit beta 2; MYSB; CAVB2; CACNLB2; FLJ23743; |
Gene ID | 783 |
mRNA Refseq | NM_000724 |
Protein Refseq | NP_000715 |
MIM | 600003 |
UniProt ID | Q08289 |
◆ Recombinant Proteins | ||
CACNB2-1069R | Recombinant Rat CACNB2 Protein | +Inquiry |
CACNB2-7856H | Recombinant Human CACNB2 protein, His-tagged | +Inquiry |
CACNB2-26766TH | Recombinant Human CACNB2 | +Inquiry |
CACNB2-7855H | Recombinant Human CACNB2 protein, GST-tagged | +Inquiry |
CACNB2-10639H | Recombinant Human CACNB2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNB2 Products
Required fields are marked with *
My Review for All CACNB2 Products
Required fields are marked with *