Recombinant Human CACNG3 Protein, GST-Tagged

Cat.No. : CACNG3-0276H
Product Overview : Human CACNG3 partial ORF (NP_006530, 199 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family. This gene is a susceptibility locus for childhood absence epilepsy. [provided by RefSeq, Dec 2010]
Molecular Mass : 36.63 kDa
AA Sequence : IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CACNG3 calcium channel, voltage-dependent, gamma subunit 3 [ Homo sapiens ]
Official Symbol CACNG3
Synonyms CACNG3; calcium channel, voltage-dependent, gamma subunit 3; voltage-dependent calcium channel gamma-3 subunit; TARP gamma-3; voltage-gated calcium channel gamma subunit; transmembrane AMPAR regulatory protein gamma-3; neuronal voltage-gated calcium channel gamma-3 subunit;
Gene ID 10368
mRNA Refseq NM_006539
Protein Refseq NP_006530
MIM 606403
UniProt ID O60359

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNG3 Products

Required fields are marked with *

My Review for All CACNG3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon