Recombinant Human CAD protein, His-tagged
| Cat.No. : | CAD-2323H |
| Product Overview : | Recombinant Human CAD protein(P27708)(1456-1846aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1456-1846 aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Molecular Mass : | 43.5 kDa |
| AASequence : | MTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPD |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | CAD carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [ Homo sapiens ] |
| Official Symbol | CAD |
| Synonyms | CAD; carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase; CAD protein; CAD trifunctional protein; multifunctional protein CAD; |
| mRNA Refseq | NM_004341 |
| Protein Refseq | NP_004332 |
| MIM | 114010 |
| UniProt ID | P27708 |
| Gene ID | 790 |
| ◆ Recombinant Proteins | ||
| CAD-2634M | Recombinant Mouse CAD Protein | +Inquiry |
| CAD-1179M | Recombinant Mouse CAD Protein, His (Fc)-Avi-tagged | +Inquiry |
| CAD-10649H | Recombinant Human CAD, His-tagged | +Inquiry |
| CAD-50H | Recombinant Human CAD protein, SUMO-His-tagged | +Inquiry |
| CAD-2322H | Recombinant Human CAD protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAD Products
Required fields are marked with *
My Review for All CAD Products
Required fields are marked with *
