Recombinant Human CADM1 Protein, GST-Tagged
Cat.No. : | CADM1-0282H |
Product Overview : | Human CADM1 partial ORF (NP_055148, 151 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CADM1 (Cell Adhesion Molecule 1) is a Protein Coding gene. Diseases associated with CADM1 include Retroperitoneal Fibrosis and Lung Cancer. Among its related pathways are Natural Killer Cell Receptors: Human Target Cell – NK Cell Ligand-Receptor Interactions and Cell junction organization. GO annotations related to this gene include protein homodimerization activity and PDZ domain binding. An important paralog of this gene is CADM2. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CADM1 cell adhesion molecule 1 [ Homo sapiens ] |
Official Symbol | CADM1 |
Synonyms | CADM1; cell adhesion molecule 1; IGSF4, immunoglobulin superfamily, member 4, TSLC1, tumor suppressor in lung cancer 1; BL2; IGSF4A; Necl 2; NECL2; nectin like 2; RA175; ST17; SYNCAM; SYNCAM1; TSLC-1; nectin-like 2; nectin-like protein 2; truncated CADM1 protein; TSLC1/Nectin-like 2/IGSF4; synaptic cell adhesion molecule; tumor suppressor in lung cancer 1; immunoglobulin superfamily member 4; immunoglobulin superfamily, member 4; spermatogenic immunoglobulin superfamily; immunoglobulin superfamily, member 4D variant 2; IGSF4; TSLC1; Necl-2; sgIGSF; sTSLC-1; synCAM1; MGC51880; MGC149785; DKFZp686F1789; |
Gene ID | 23705 |
mRNA Refseq | NM_001098517 |
Protein Refseq | NP_001091987 |
MIM | 605686 |
UniProt ID | Q9BY67 |
◆ Recombinant Proteins | ||
CADM1-1524HFL | Recombinant Full Length Human CADM1 Protein, C-Flag-tagged | +Inquiry |
CADM1-2260H | Recombinant Human CADM1 Protein, MYC/DDK-tagged | +Inquiry |
CADM1-428H | Recombinant Human CADM1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cadm1-1180M | Recombinant Mouse Cadm1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CADM1-1182M | Recombinant Mouse CADM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CADM1-2527HCL | Recombinant Human CADM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CADM1 Products
Required fields are marked with *
My Review for All CADM1 Products
Required fields are marked with *
0
Inquiry Basket