Recombinant Human CADM1 Protein, GST-Tagged

Cat.No. : CADM1-0282H
Product Overview : Human CADM1 partial ORF (NP_055148, 151 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CADM1 (Cell Adhesion Molecule 1) is a Protein Coding gene. Diseases associated with CADM1 include Retroperitoneal Fibrosis and Lung Cancer. Among its related pathways are Natural Killer Cell Receptors: Human Target Cell – NK Cell Ligand-Receptor Interactions and Cell junction organization. GO annotations related to this gene include protein homodimerization activity and PDZ domain binding. An important paralog of this gene is CADM2.
Molecular Mass : 36.74 kDa
AA Sequence : IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CADM1 cell adhesion molecule 1 [ Homo sapiens ]
Official Symbol CADM1
Synonyms CADM1; cell adhesion molecule 1; IGSF4, immunoglobulin superfamily, member 4, TSLC1, tumor suppressor in lung cancer 1; BL2; IGSF4A; Necl 2; NECL2; nectin like 2; RA175; ST17; SYNCAM; SYNCAM1; TSLC-1; nectin-like 2; nectin-like protein 2; truncated CADM1 protein; TSLC1/Nectin-like 2/IGSF4; synaptic cell adhesion molecule; tumor suppressor in lung cancer 1; immunoglobulin superfamily member 4; immunoglobulin superfamily, member 4; spermatogenic immunoglobulin superfamily; immunoglobulin superfamily, member 4D variant 2; IGSF4; TSLC1; Necl-2; sgIGSF; sTSLC-1; synCAM1; MGC51880; MGC149785; DKFZp686F1789;
Gene ID 23705
mRNA Refseq NM_001098517
Protein Refseq NP_001091987
MIM 605686
UniProt ID Q9BY67

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CADM1 Products

Required fields are marked with *

My Review for All CADM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon