Recombinant Human CADM1 Protein, GST-Tagged
| Cat.No. : | CADM1-0282H |
| Product Overview : | Human CADM1 partial ORF (NP_055148, 151 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CADM1 (Cell Adhesion Molecule 1) is a Protein Coding gene. Diseases associated with CADM1 include Retroperitoneal Fibrosis and Lung Cancer. Among its related pathways are Natural Killer Cell Receptors: Human Target Cell – NK Cell Ligand-Receptor Interactions and Cell junction organization. GO annotations related to this gene include protein homodimerization activity and PDZ domain binding. An important paralog of this gene is CADM2. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CADM1 cell adhesion molecule 1 [ Homo sapiens ] |
| Official Symbol | CADM1 |
| Synonyms | CADM1; cell adhesion molecule 1; IGSF4, immunoglobulin superfamily, member 4, TSLC1, tumor suppressor in lung cancer 1; BL2; IGSF4A; Necl 2; NECL2; nectin like 2; RA175; ST17; SYNCAM; SYNCAM1; TSLC-1; nectin-like 2; nectin-like protein 2; truncated CADM1 protein; TSLC1/Nectin-like 2/IGSF4; synaptic cell adhesion molecule; tumor suppressor in lung cancer 1; immunoglobulin superfamily member 4; immunoglobulin superfamily, member 4; spermatogenic immunoglobulin superfamily; immunoglobulin superfamily, member 4D variant 2; IGSF4; TSLC1; Necl-2; sgIGSF; sTSLC-1; synCAM1; MGC51880; MGC149785; DKFZp686F1789; |
| Gene ID | 23705 |
| mRNA Refseq | NM_001098517 |
| Protein Refseq | NP_001091987 |
| MIM | 605686 |
| UniProt ID | Q9BY67 |
| ◆ Recombinant Proteins | ||
| CADM1-2635M | Recombinant Mouse CADM1 Protein | +Inquiry |
| Cadm1-712M | Recombinant Mouse Cadm1 protein, His-tagged | +Inquiry |
| CADM1-484H | Recombinant Human CADM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CADM1-112H | Recombinant Human CADM1 Protein, His-tagged | +Inquiry |
| Cadm1-1181M | Recombinant Mouse Cadm1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CADM1-2527HCL | Recombinant Human CADM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CADM1 Products
Required fields are marked with *
My Review for All CADM1 Products
Required fields are marked with *



