Recombinant Human CALB1 protein, His&Myc-tagged
| Cat.No. : | CALB1-6363H |
| Product Overview : | Recombinant Human CALB1 protein(P05937)(2-261aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-261a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | AESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN |
| Gene Name | CALB1 calbindin 1, 28kDa [ Homo sapiens ] |
| Official Symbol | CALB1 |
| Synonyms | CALB1; calbindin 1, 28kDa; CALB; calbindin; D-28K; calbindin D28; RTVL-H protein; calbindin 1, (28kD); vitamin D-dependent calcium-binding protein, avian-type; |
| Gene ID | 793 |
| mRNA Refseq | NM_004929 |
| Protein Refseq | NP_004920 |
| MIM | 114050 |
| UniProt ID | P05937 |
| ◆ Recombinant Proteins | ||
| CALB1-6363H | Recombinant Human CALB1 protein, His&Myc-tagged | +Inquiry |
| Calb1-251R | Recombinant Rat Calbindin 1 | +Inquiry |
| CALB1-10656H | Recombinant Human CALB1, His-tagged | +Inquiry |
| CALB1-3342H | Recombinant Human CALB1 protein, His-tagged | +Inquiry |
| CALB1-355H | Recombinant Human CALB1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CALB1-7897HCL | Recombinant Human CALB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALB1 Products
Required fields are marked with *
My Review for All CALB1 Products
Required fields are marked with *
