Recombinant Human CALCA Protein, His-tagged
| Cat.No. : | CALCA-817H |
| Product Overview : | Recombinant Human CALCA, transcript variant 2, fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Molecular Mass : | 10.5kD |
| AA Sequence : | YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANVEHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | CALCA calcitonin-related polypeptide alpha [ Homo sapiens ] |
| Official Symbol | CALCA |
| Synonyms | CALCA; calcitonin-related polypeptide alpha; CALC1, calcitonin 1; calcitonin; calcitonin gene-related peptide 1; calcitonin; katacalcin; calcitonin 1; alpha-type CGRP; calcitonin gene-related peptide I; calcitonin/calcitonin-related polypeptide, alpha; CT; KC; CGRP; CALC1; CGRP1; CGRP-I; MGC126648; |
| Gene ID | 796 |
| mRNA Refseq | NM_001033952 |
| Protein Refseq | NP_001029124 |
| MIM | 114130 |
| UniProt ID | P01258 |
| ◆ Recombinant Proteins | ||
| CALCA-817H | Recombinant Human CALCA Protein, His-tagged | +Inquiry |
| CALCA-0811H | Recombinant Human CALCA Protein (Ala26-Asn141), C-His tagged | +Inquiry |
| CALCA-5181H | Recombinant Human CALCA Protein (Met1-Asn141), C-His tagged | +Inquiry |
| CALCA-07H | Recombinant Human CALCA Protein | +Inquiry |
| CALCA-230H | Recombinant Human CALCA, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CALCA-7895HCL | Recombinant Human CALCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALCA Products
Required fields are marked with *
My Review for All CALCA Products
Required fields are marked with *
