Recombinant Human CALM2 protein, GST-tagged
Cat.No. : | CALM2-301253H |
Product Overview : | Recombinant Human CALM2 (72-149 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met72-Lys149 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CALM2 calmodulin 2 (phosphorylase kinase, delta) [ Homo sapiens ] |
Official Symbol | CALM2 |
Synonyms | CALM2; calmodulin 2 (phosphorylase kinase, delta); calmodulin; CAMII; PHKD; caM; LP7057 protein; phosphorylase kinase delta; CALM1; CALM3; PHKD2; FLJ99410; |
Gene ID | 805 |
mRNA Refseq | NM_001743 |
Protein Refseq | NP_001734 |
MIM | 114182 |
UniProt ID | P62158 |
◆ Recombinant Proteins | ||
CALM2-571H | Recombinant Human CALM2, His tagged | +Inquiry |
CALM2-1190M | Recombinant Mouse CALM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CALM2-0304H | Recombinant Human CALM2 Protein, GST-Tagged | +Inquiry |
CALM2-4558H | Recombinant Human CALM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CALM2-2651M | Recombinant Mouse CALM2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALM2-7889HCL | Recombinant Human CALM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALM2 Products
Required fields are marked with *
My Review for All CALM2 Products
Required fields are marked with *