Recombinant Human CALM3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CALM3-2233H
Product Overview : CALM3 MS Standard C13 and N15-labeled recombinant protein (NP_005175) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a family of proteins that binds calcium and functions as a enzymatic co-factor. Activity of this protein is important in the regulation of the cell cycle and cytokinesis. Multiple alternatively spliced transcript variants have been observed at this gene.
Molecular Mass : 16.8 kDa
AA Sequence : MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CALM3 calmodulin 3 [ Homo sapiens (human) ]
Official Symbol CALM3
Synonyms CALM3; calmodulin 3 (phosphorylase kinase, delta); calmodulin; PHKD; caM; CALM1; CALM2; PHKD3;
Gene ID 808
mRNA Refseq NM_005184
Protein Refseq NP_005175
MIM 114183
UniProt ID P62158

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALM3 Products

Required fields are marked with *

My Review for All CALM3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon