Recombinant Human CALM3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CALM3-2233H |
| Product Overview : | CALM3 MS Standard C13 and N15-labeled recombinant protein (NP_005175) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of a family of proteins that binds calcium and functions as a enzymatic co-factor. Activity of this protein is important in the regulation of the cell cycle and cytokinesis. Multiple alternatively spliced transcript variants have been observed at this gene. |
| Molecular Mass : | 16.8 kDa |
| AA Sequence : | MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CALM3 calmodulin 3 [ Homo sapiens (human) ] |
| Official Symbol | CALM3 |
| Synonyms | CALM3; calmodulin 3 (phosphorylase kinase, delta); calmodulin; PHKD; caM; CALM1; CALM2; PHKD3; |
| Gene ID | 808 |
| mRNA Refseq | NM_005184 |
| Protein Refseq | NP_005175 |
| MIM | 114183 |
| UniProt ID | P62158 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALM3 Products
Required fields are marked with *
My Review for All CALM3 Products
Required fields are marked with *



