Recombinant Human CALM3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CALM3-2233H |
Product Overview : | CALM3 MS Standard C13 and N15-labeled recombinant protein (NP_005175) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of a family of proteins that binds calcium and functions as a enzymatic co-factor. Activity of this protein is important in the regulation of the cell cycle and cytokinesis. Multiple alternatively spliced transcript variants have been observed at this gene. |
Molecular Mass : | 16.8 kDa |
AA Sequence : | MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CALM3 calmodulin 3 [ Homo sapiens (human) ] |
Official Symbol | CALM3 |
Synonyms | CALM3; calmodulin 3 (phosphorylase kinase, delta); calmodulin; PHKD; caM; CALM1; CALM2; PHKD3; |
Gene ID | 808 |
mRNA Refseq | NM_005184 |
Protein Refseq | NP_005175 |
MIM | 114183 |
UniProt ID | P62158 |
◆ Recombinant Proteins | ||
CALM3-093H | Recombinant Human CALM3 protein, GST-tagged | +Inquiry |
Calm3-747M | Recombinant Mouse Calm3 Protein, MYC/DDK-tagged | +Inquiry |
CALM3-30H | Recombinant Human CALM3 protein, His-tagged | +Inquiry |
CALM3-2291H | Recombinant Human CALM3 Protein, MYC/DDK-tagged | +Inquiry |
CALM3-26629TH | Recombinant Human CALM3, His-tagged | +Inquiry |
◆ Native Proteins | ||
CALM3-74B | Native Bovine Calmodulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALM3-7888HCL | Recombinant Human CALM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALM3 Products
Required fields are marked with *
My Review for All CALM3 Products
Required fields are marked with *
0
Inquiry Basket