Recombinant Human CALM3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CALM3-2233H
• Product Overview: CALM3 MS Standard C13 and N15-labeled recombinant protein (NP_005175) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of a family of proteins that binds calcium and functions as a enzymatic co-factor. Activity of this protein is important in the regulation of the cell cycle and cytokinesis. Multiple alternatively spliced transcript variants have been observed at this gene.
• Molecular Mass: 16.8 kDa
• AA Sequence: MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CALM3 calmodulin 3 [ Homo sapiens (human) ]
• Official Symbol: CALM3
• Synonyms: CALM3; calmodulin 3 (phosphorylase kinase, delta); calmodulin; PHKD; caM; CALM1; CALM2; PHKD3
• Gene ID: 808
• mRNA Refseq: NM_005184
• Protein Refseq: NP_005175
• MIM: 114183
• UniProt ID: P62158