Recombinant Human CALML4 protein, His-tagged
Cat.No. : | CALML4-1473H |
Product Overview : | Recombinant Human CALML4 protein(49-196 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 49-196 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | QPRPQNEYKECFSLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | CALML4 calmodulin-like 4 [ Homo sapiens ] |
Official Symbol | CALML4 |
Synonyms | CALML4; calmodulin-like 4; calmodulin-like protein 4; MGC4809; NY BR 20; serologically defined breast cancer antigen NY-BR-20; NY-BR-20; |
mRNA Refseq | NM_001031733 |
Protein Refseq | NP_001026903 |
UniProt ID | Q96GE6 |
Gene ID | 91860 |
◆ Recombinant Proteins | ||
CALML4-10672H | Recombinant Human CALML4 protein, GST-tagged | +Inquiry |
CALML4-5008C | Recombinant Chicken CALML4 | +Inquiry |
Calml4-1940M | Recombinant Mouse Calml4 Protein, Myc/DDK-tagged | +Inquiry |
CALML4-1473H | Recombinant Human CALML4 protein, His-tagged | +Inquiry |
CALML4-2289H | Recombinant Human CALML4 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALML4 Products
Required fields are marked with *
My Review for All CALML4 Products
Required fields are marked with *