Recombinant Human CALML4 protein, GST-tagged
| Cat.No. : | CALML4-10672H |
| Product Overview : | Recombinant Human CALML4 protein(49-196 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 49-196 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | QPRPQNEYKECFSLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | CALML4 calmodulin-like 4 [ Homo sapiens ] |
| Official Symbol | CALML4 |
| Synonyms | CALML4; calmodulin-like 4; calmodulin-like protein 4; MGC4809; NY BR 20; serologically defined breast cancer antigen NY-BR-20; NY-BR-20; |
| mRNA Refseq | NM_001031733 |
| Protein Refseq | NP_001026903 |
| UniProt ID | Q96GE6 |
| Gene ID | 91860 |
| ◆ Recombinant Proteins | ||
| CALML4-5008C | Recombinant Chicken CALML4 | +Inquiry |
| Calml4-1940M | Recombinant Mouse Calml4 Protein, Myc/DDK-tagged | +Inquiry |
| CALML4-10672H | Recombinant Human CALML4 protein, GST-tagged | +Inquiry |
| CALML4-5756H | Recombinant Human CALML4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CALML4-1473H | Recombinant Human CALML4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALML4 Products
Required fields are marked with *
My Review for All CALML4 Products
Required fields are marked with *
