Recombinant Human CALML6 Protein, GST-Tagged
Cat.No. : | CALML6-0309H |
Product Overview : | Human CALML6 full-length ORF (AAI60060.1, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CALML6 (Calmodulin Like 6) is a Protein Coding gene. Among its related pathways are Vascular smooth muscle contraction and Tuberculosis. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CALM2. |
Molecular Mass : | 46.31 kDa |
AA Sequence : | MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CALML6 calmodulin like 6 [ Homo sapiens (human) ] |
Official Symbol | CALML6 |
Synonyms | CALML6; calmodulin like 6; calmodulin-like protein 6; EF-hand protein; calglandulin-like protein; CAGLP; Calmodulin Like 6; Calglandulin-Like Protein; CAGLP; Calmodulin-Like Protein 6; Calmodulin-Like 6; EF-Hand Protein; CALGP |
Gene ID | 163688 |
mRNA Refseq | NM_001330313 |
Protein Refseq | NP_001317242 |
MIM | 610171 |
UniProt ID | Q8TD86 |
◆ Recombinant Proteins | ||
CALML6-0309H | Recombinant Human CALML6 Protein, GST-Tagged | +Inquiry |
CALML6-3067HF | Recombinant Full Length Human CALML6 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALML6 Products
Required fields are marked with *
My Review for All CALML6 Products
Required fields are marked with *