Recombinant Human Calmodulin3, GST-tagged

• Cat.No.: CALM3-91H
• Product Overview: The recombinant human Calmodulin3 (53 a.a.-149 a.a.), fused with an N-terminal GST tag, was expressed in Wheat germ in vitro.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 53-149 a.a.
• Description: Calmodulin mediates the control of a large number of enzymes and other proteins by Ca2+. Among the enzymes to be stimulated by the calmodulin-Ca2+ complex are a number of protein kinases and phosphatases. Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis.
• AA Sequence: INEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
• Molecular weight: 36.41kDa
• Formulation: Liquid, in the elution buffer (50 mMTris-HCI, 10 mM reduced Glutathione, pH=8.0)
• Stability: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Purification: H
• Function: N-terminal myristoylation domain binding; calcium ion binding; calcium-dependent protein binding; phosphatidylinositol 3-kinase binding; phospholipase binding; protein domain specific binding; thioesterase binding; titin binding; protein binding

Gene Information

• Gene Name: CALM3 calmodulin 3 (phosphorylase kinase, delta) [ Homo sapiens ]
• Official Symbol: CALM3
• Synonyms: CALM3; PHKD; PHKD3; calmodulin 3 (phosphorylase kinase, delta); calmodulin; caM
• Gene ID: 808
• mRNA Refseq: NM_005184
• Protein Refseq: NP_005175
• MIM: 114183
• UniProt ID: P62158
• Chromosome Location: 19q13.2-q13.3
• Pathway: Activation of Ca-permeable Kainate Receptor; Activation of CaMK IV; Activation of Kainate Receptors upon glutamate binding; Activation of NMDA receptor upon glutamate binding and postsynaptic events; Adaptive Immune System; Alcoholism; Alzheimer's disease; Amphetamine addiction; BCR signaling pathway