Recombinant Human Calmodulin3, GST-tagged
Cat.No. : | CALM3-91H |
Product Overview : | The recombinant human Calmodulin3 (53 a.a.-149 a.a.), fused with an N-terminal GST tag, was expressed in Wheat germ in vitro. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human | ||
Source : | Wheat Germ | ||
Tag : | GST | ||
Protein Length : | 53-149 a.a. | ||
Description : | Calmodulin mediates the control of a large number of enzymes and other proteins by Ca2+. Among the enzymes to be stimulated by the calmodulin-Ca2+ complex are a number of protein kinases and phosphatases. Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis. | ||
AA Sequence : | INEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK | ||
Molecular weight : | 36.41kDa | ||
Formulation : | Liquid, in the elution buffer (50 mMTris-HCI, 10 mM reduced Glutathione, pH=8.0) | ||
Stability : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. | ||
Purification : | H | ||
nullValue_other : |
|
Gene Name | CALM3 calmodulin 3 (phosphorylase kinase, delta) [ Homo sapiens ] |
Official Symbol | CALM3 |
Synonyms | CALM3; PHKD; PHKD3; calmodulin 3 (phosphorylase kinase, delta); calmodulin; caM |
Gene ID | 808 |
mRNA Refseq | NM_005184 |
Protein Refseq | NP_005175 |
MIM | 114183 |
UniProt ID | P62158 |
Chromosome Location | 19q13.2-q13.3 |
Pathway | Activation of Ca-permeable Kainate Receptor; Activation of CaMK IV; Activation of Kainate Receptors upon glutamate binding; Activation of NMDA receptor upon glutamate binding and postsynaptic events; Adaptive Immune System; Alcoholism; Alzheimer's disease; Amphetamine addiction; BCR signaling pathway |
◆ Recombinant Proteins | ||
CALM3-1095R | Recombinant Rat CALM3 Protein | +Inquiry |
CALM3-26628TH | Recombinant Human CALM3 | +Inquiry |
Calm3-747M | Recombinant Mouse Calm3 Protein, MYC/DDK-tagged | +Inquiry |
CALM3-2291H | Recombinant Human CALM3 Protein, MYC/DDK-tagged | +Inquiry |
CALM3-92H | Recombinant Human CALM3, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CALM3-74B | Native Bovine Calmodulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALM3-7888HCL | Recombinant Human CALM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALM3 Products
Required fields are marked with *
My Review for All CALM3 Products
Required fields are marked with *
0
Inquiry Basket