Recombinant Human CALR Protein

Cat.No. : CALR-06H
Product Overview : Recombinant Human CALR Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Calreticulin is a highly conserved chaperone protein which resides primarily in the endoplasmic reticulum, and is involved in a variety of cellular processes, among them, cell adhesion. Additionally, it functions in protein folding quality control and calcium homeostasis. Calreticulin is also found in the nucleus, suggesting that it may have a role in transcription regulation. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin. Recurrent mutations in calreticulin have been linked to various neoplasms, including the myeloproliferative type.
Form : Liquid. In 20 mM Tris-HCl, 150 mM NaCl, 5 mM CaCl2, pH 8.0, with 10% glycerol.
Molecular Mass : ~45 kDa
AA Sequence : MSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Endotoxin : <1 EU/ug as determined by LAL method.
Purity : >90%
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.17 mg/ml
Official Full Name : Calreticulin
Gene Name CALR calreticulin [ Homo sapiens (human) ]
Official Symbol CALR
Synonyms RO; CRT; SSA; cC1qR; HEL-S-99n
Gene ID 811
mRNA Refseq NM_004343
Protein Refseq NP_004334
MIM 109091
UniProt ID P27797

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALR Products

Required fields are marked with *

My Review for All CALR Products

Required fields are marked with *

0
cart-icon
0
compare icon