Recombinant Human CALR protein(91-230 aa), C-His-tagged

• Cat.No.: CALR-2706H
• Product Overview: Recombinant Human CALR protein(P27797)(91-230 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 91-230 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTD

Gene Information

• Gene Name: CALR calreticulin [ Homo sapiens ]
• Official Symbol: CALR
• Synonyms: CALR; calreticulin; autoantigen Ro; cC1qR; CRT; FLJ26680; RO; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA; CRP55; ERp60; HACBP; grp60; calregulin; endoplasmic reticulum resident protein 60; Sicca syndrome antigen A (autoantigen Ro; calreticulin)
• Gene ID: 811
• mRNA Refseq: NM_004343
• Protein Refseq: NP_004334
• MIM: 109091
• UniProt ID: P27797