Recombinant Human CALR protein(91-230 aa), C-His-tagged

Cat.No. : CALR-2706H
Product Overview : Recombinant Human CALR protein(P27797)(91-230 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 91-230 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTD
Gene Name CALR calreticulin [ Homo sapiens ]
Official Symbol CALR
Synonyms CALR; calreticulin; autoantigen Ro; cC1qR; CRT; FLJ26680; RO; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA; CRP55; ERp60; HACBP; grp60; calregulin; endoplasmic reticulum resident protein 60; Sicca syndrome antigen A (autoantigen Ro; calreticulin);
Gene ID 811
mRNA Refseq NM_004343
Protein Refseq NP_004334
MIM 109091
UniProt ID P27797

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALR Products

Required fields are marked with *

My Review for All CALR Products

Required fields are marked with *

0
cart-icon