Recombinant Human CALR protein(91-230 aa), C-His-tagged
Cat.No. : | CALR-2706H |
Product Overview : | Recombinant Human CALR protein(P27797)(91-230 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91-230 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTD |
Gene Name | CALR calreticulin [ Homo sapiens ] |
Official Symbol | CALR |
Synonyms | CALR; calreticulin; autoantigen Ro; cC1qR; CRT; FLJ26680; RO; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA; CRP55; ERp60; HACBP; grp60; calregulin; endoplasmic reticulum resident protein 60; Sicca syndrome antigen A (autoantigen Ro; calreticulin); |
Gene ID | 811 |
mRNA Refseq | NM_004343 |
Protein Refseq | NP_004334 |
MIM | 109091 |
UniProt ID | P27797 |
◆ Recombinant Proteins | ||
CALR-2764H | Recombinant Human CALR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CALR-301231H | Recombinant Human CALR protein, GST-tagged | +Inquiry |
CALR-8675Z | Recombinant Zebrafish CALR | +Inquiry |
CALR-377M | Recombinant Mouse CALR Protein (18-416 aa), GST-tagged | +Inquiry |
CALR-524H | Recombinant Human CALR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALR Products
Required fields are marked with *
My Review for All CALR Products
Required fields are marked with *
0
Inquiry Basket