Recombinant Human CALR protein(91-230 aa), C-His-tagged
| Cat.No. : | CALR-2706H |
| Product Overview : | Recombinant Human CALR protein(P27797)(91-230 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 91-230 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | LVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTD |
| Gene Name | CALR calreticulin [ Homo sapiens ] |
| Official Symbol | CALR |
| Synonyms | CALR; calreticulin; autoantigen Ro; cC1qR; CRT; FLJ26680; RO; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA; CRP55; ERp60; HACBP; grp60; calregulin; endoplasmic reticulum resident protein 60; Sicca syndrome antigen A (autoantigen Ro; calreticulin); |
| Gene ID | 811 |
| mRNA Refseq | NM_004343 |
| Protein Refseq | NP_004334 |
| MIM | 109091 |
| UniProt ID | P27797 |
| ◆ Recombinant Proteins | ||
| CALR-377M | Recombinant Mouse CALR Protein (18-416 aa), GST-tagged | +Inquiry |
| Calr-357R | Recombinant Rat Calr Protein, His-tagged | +Inquiry |
| CALR-5643H | Recombinant Human CALR protein, His&Flag-tagged | +Inquiry |
| CALR-06H | Recombinant Human CALR Protein | +Inquiry |
| CALR-2764H | Recombinant Human CALR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
| CALR-080HKCL | Human CALR Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALR Products
Required fields are marked with *
My Review for All CALR Products
Required fields are marked with *
