Recombinant Human CAMK2A protein, His-tagged
Cat.No. : | CAMK2A-3394H |
Product Overview : | Recombinant Human TMEM175 protein(222-313 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 222-313 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | YVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAY |
Gene Name | TMEM175 transmembrane protein 175 [ Homo sapiens ] |
Official Symbol | TMEM175 |
Synonyms | TMEM175; transmembrane protein 175; MGC4618; |
Gene ID | 84286 |
mRNA Refseq | NM_032326 |
Protein Refseq | NP_115702 |
UniProt ID | Q9BSA9 |
◆ Recombinant Proteins | ||
Camk2a-751M | Recombinant Mouse Camk2a Protein, MYC/DDK-tagged | +Inquiry |
CAMK2A-765R | Recombinant Rat CAMK2A Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMK2A-3394H | Recombinant Human CAMK2A protein, His-tagged | +Inquiry |
CAMK2A-3395H | Recombinant Human CAMK2A protein, His-tagged | +Inquiry |
CAMK2A-508HFL | Active Recombinant Full Length Human CAMK2A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK2A-7880HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
CAMK2A-7881HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMK2A Products
Required fields are marked with *
My Review for All CAMK2A Products
Required fields are marked with *