Recombinant Human CAMK2N1 protein, His-Trx-tagged
Cat.No. : | CAMK2N1-2626H |
Product Overview : | Recombinant Human CAMK2N1 protein(Q7Z7J9)(1-78aa), fused to N-terminal His tag and Trx tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Trx |
Protein Length : | 1-78aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.6 kDa |
AA Sequence : | MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CAMK2N1 calcium/calmodulin-dependent protein kinase II inhibitor 1 [ Homo sapiens ] |
Official Symbol | CAMK2N1 |
Synonyms | PRO1489; RP11-401M16.1; calcium/calmodulin-dependent protein kinase II inhibitor 1; CaMKIINalpha; CAMK2N1 |
Gene ID | 55450 |
mRNA Refseq | NM_018584.5 |
Protein Refseq | NP_061054.2 |
UniProt ID | Q7Z7J9 |
◆ Recombinant Proteins | ||
CAMK2N1-5071H | Recombinant Human CAMK2N1, His-tagged | +Inquiry |
CAMK2N1-10685H | Recombinant Human CAMK2N1, GST-tagged | +Inquiry |
CAMK2N1-378M | Recombinant Mouse CAMK2N1 Protein (1-78 aa), His-SUMO-tagged | +Inquiry |
CAMK2N1-615R | Recombinant Rhesus monkey CAMK2N1 Protein, His-tagged | +Inquiry |
CAMK2N1-1104R | Recombinant Rat CAMK2N1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK2N1-7875HCL | Recombinant Human CAMK2N1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAMK2N1 Products
Required fields are marked with *
My Review for All CAMK2N1 Products
Required fields are marked with *
0
Inquiry Basket