Recombinant Mouse CAMK2N1 Protein (1-78 aa), His-SUMO-tagged

• Cat.No.: CAMK2N1-378M
• Product Overview: Recombinant Mouse CAMK2N1 Protein (1-78 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-78 aa
• Description: Potent and specific inhibitor of CaM-kinase II (CAMK2).
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 24.5 kDa
• AA Sequence: MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Camk2n1 calcium/calmodulin-dependent protein kinase II inhibitor 1 [ Mus musculus (house mouse) ]
• Official Symbol: CAMK2N1
• Synonyms: AI848599; AI891706; 1810006K23Rik
• Gene ID: 66259
• mRNA Refseq: NM_025451
• Protein Refseq: NP_079727
• UniProt ID: Q6QWF9