Recombinant Mouse CAMK2N1 Protein (1-78 aa), His-SUMO-tagged
Cat.No. : | CAMK2N1-378M |
Product Overview : | Recombinant Mouse CAMK2N1 Protein (1-78 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-78 aa |
Description : | Potent and specific inhibitor of CaM-kinase II (CAMK2). |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 24.5 kDa |
AA Sequence : | MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Camk2n1 calcium/calmodulin-dependent protein kinase II inhibitor 1 [ Mus musculus (house mouse) ] |
Official Symbol | CAMK2N1 |
Synonyms | AI848599; AI891706; 1810006K23Rik; |
Gene ID | 66259 |
mRNA Refseq | NM_025451 |
Protein Refseq | NP_079727 |
UniProt ID | Q6QWF9 |
◆ Recombinant Proteins | ||
CAMK2N1-378M | Recombinant Mouse CAMK2N1 Protein (1-78 aa), His-SUMO-tagged | +Inquiry |
CAMK2N1-1104R | Recombinant Rat CAMK2N1 Protein | +Inquiry |
CAMK2N1-2626H | Recombinant Human CAMK2N1 protein, His-Trx-tagged | +Inquiry |
CAMK2N1-10685H | Recombinant Human CAMK2N1, GST-tagged | +Inquiry |
CAMK2N1-470H | Recombinant Human calcium/calmodulin-dependent protein kinase II inhibitor 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK2N1-7875HCL | Recombinant Human CAMK2N1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMK2N1 Products
Required fields are marked with *
My Review for All CAMK2N1 Products
Required fields are marked with *
0
Inquiry Basket