Recombinant Human CAMK2N2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CAMK2N2-5607H |
| Product Overview : | CAMK2N2 MS Standard C13 and N15-labeled recombinant protein (NP_150284) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity through the phosphorylation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid-type glutamate (AMPA) receptors. Studies of the similar protein in rat suggest that this protein may function as a negative regulator of CaM-KII and may act to inhibit the phosphorylation of AMPA receptors. |
| Molecular Mass : | 8.7 kDa |
| AA Sequence : | MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CAMK2N2 calcium/calmodulin-dependent protein kinase II inhibitor 2 [ Homo sapiens (human) ] |
| Official Symbol | CAMK2N2 |
| Synonyms | CAMK2N2; calcium/calmodulin-dependent protein kinase II inhibitor 2; CaM KIIN; CaM-KII inhibitory protein; CAMKIIN; CAM-KIIN; |
| Gene ID | 94032 |
| mRNA Refseq | NM_033259 |
| Protein Refseq | NP_150284 |
| MIM | 608721 |
| UniProt ID | Q96S95 |
| ◆ Recombinant Proteins | ||
| Camk2n2-1945M | Recombinant Mouse Camk2n2 Protein, Myc/DDK-tagged | +Inquiry |
| CAMK2N2-2491H | Recombinant Human CAMK2N2 Protein, MYC/DDK-tagged | +Inquiry |
| CAMK2N2-301339H | Recombinant Human CAMK2N2 protein, GST-tagged | +Inquiry |
| CAMK2N2-769R | Recombinant Rat CAMK2N2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CAMK2N2-1105R | Recombinant Rat CAMK2N2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAMK2N2-144HCL | Recombinant Human CAMK2N2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMK2N2 Products
Required fields are marked with *
My Review for All CAMK2N2 Products
Required fields are marked with *
