Recombinant Human CAMK2N2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CAMK2N2-5607H
Product Overview : CAMK2N2 MS Standard C13 and N15-labeled recombinant protein (NP_150284) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity through the phosphorylation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid-type glutamate (AMPA) receptors. Studies of the similar protein in rat suggest that this protein may function as a negative regulator of CaM-KII and may act to inhibit the phosphorylation of AMPA receptors.
Molecular Mass : 8.7 kDa
AA Sequence : MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CAMK2N2 calcium/calmodulin-dependent protein kinase II inhibitor 2 [ Homo sapiens (human) ]
Official Symbol CAMK2N2
Synonyms CAMK2N2; calcium/calmodulin-dependent protein kinase II inhibitor 2; CaM KIIN; CaM-KII inhibitory protein; CAMKIIN; CAM-KIIN;
Gene ID 94032
mRNA Refseq NM_033259
Protein Refseq NP_150284
MIM 608721
UniProt ID Q96S95

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAMK2N2 Products

Required fields are marked with *

My Review for All CAMK2N2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon