Recombinant Human CAMKMT protein, His-tagged
Cat.No. : | CAMKMT-3389H |
Product Overview : | Recombinant Human CAMKMT protein, fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEGHFDIVMCADCLFLDQYRASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CAMKMT calmodulin-lysine N-methyltransferase [ Homo sapiens ] |
Official Symbol | CAMKMT |
Synonyms | CAMKMT; calmodulin-lysine N-methyltransferase; C2orf34, chromosome 2 open reading frame 34; CaM KMT; CLNMT; calmodulin methyltransferase; Cam; KMT; C2orf34; FLJ23451; |
Gene ID | 79823 |
mRNA Refseq | NM_024766 |
Protein Refseq | NP_079042 |
MIM | 609559 |
UniProt ID | Q7Z624 |
◆ Recombinant Proteins | ||
CAMKMT-1109R | Recombinant Rat CAMKMT Protein | +Inquiry |
CAMKMT-773R | Recombinant Rat CAMKMT Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMKMT-4972C | Recombinant Chicken CAMKMT | +Inquiry |
CAMKMT-3389H | Recombinant Human CAMKMT protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMKMT Products
Required fields are marked with *
My Review for All CAMKMT Products
Required fields are marked with *