Recombinant Human CAMLG Protein, GST-Tagged

Cat.No. : CAMLG-0344H
Product Overview : Human CAMLG full-length ORF (NP_001736.1, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq, Jul 2008]
Molecular Mass : 59.4 kDa
AA Sequence : MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CAMLG calcium modulating ligand [ Homo sapiens ]
Official Symbol CAMLG
Synonyms CAMLG; calcium modulating ligand; calcium signal-modulating cyclophilin ligand; calcium modulating cyclophilin ligand; calcium signal modulating cyclophilin ligand; CAML; cyclophilin B binding protein; cyclophilin B-binding protein; calcium-modulating cyclophilin ligand; calcium-signal modulating cyclophilin ligand; MGC163197;
Gene ID 819
mRNA Refseq NM_001745
Protein Refseq NP_001736
MIM 601118
UniProt ID P49069

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAMLG Products

Required fields are marked with *

My Review for All CAMLG Products

Required fields are marked with *

0
cart-icon
0
compare icon