Recombinant Human CAMP protein, His-SUMO & Myc-tagged
Cat.No. : | CAMP-2627H |
Product Overview : | Recombinant Human CAMP protein(P49913)(132-170aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | His-SUMO & Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.7 kDa |
Protein length : | 132-170aa |
AA Sequence : | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name : | CAMP cathelicidin antimicrobial peptide [ Homo sapiens ] |
Official Symbol : | CAMP |
Synonyms : | CAMP; cathelicidin antimicrobial peptide; CAP18; FALL 39; FALL39; LL37; 18 kDa cationic antimicrobial protein; CRAMP; HSD26; CAP-18; FALL-39; |
Gene ID : | 820 |
mRNA Refseq : | NM_004345 |
Protein Refseq : | NP_004336 |
MIM : | 600474 |
UniProt ID : | P49913 |
Products Types
◆ Recombinant Protein | ||
CAMP-1203M | Recombinant Mouse CAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMP-660H | Recombinant Human CAMP Protein, His-tagged | +Inquiry |
CAMP-3377C | Recombinant Cutibacterium acnes CAMP protein(Met1-Pro275), His-tagged | +Inquiry |
CAMP-491H | Recombinant Human CAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
Camp-661M | Recombinant Mouse Camp Protein, His/GST-tagged | +Inquiry |
◆ Lysates | ||
CAMP-7871HCL | Recombinant Human CAMP 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-0148 | cAMP Activity Assay Kit | +Inquiry |
Kit-0149 | cAMP Direct Immunoassay Kit | +Inquiry |
Kit-0866 | cAMP Direct Immunoassay Detection Kit (Fluorometric) | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket