Recombinant Human CAMP protein, His-SUMO & Myc-tagged
Cat.No. : | CAMP-2627H |
Product Overview : | Recombinant Human CAMP protein(P49913)(132-170aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 132-170aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.7 kDa |
AA Sequence : | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CAMP cathelicidin antimicrobial peptide [ Homo sapiens ] |
Official Symbol | CAMP |
Synonyms | CAMP; cathelicidin antimicrobial peptide; CAP18; FALL 39; FALL39; LL37; 18 kDa cationic antimicrobial protein; CRAMP; HSD26; CAP-18; FALL-39; |
Gene ID | 820 |
mRNA Refseq | NM_004345 |
Protein Refseq | NP_004336 |
MIM | 600474 |
UniProt ID | P49913 |
◆ Recombinant Proteins | ||
Camp-662R | Recombinant Rat Camp Protein, His/GST-tagged | +Inquiry |
CAMP-447R | Recombinant Rhesus Macaque CAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMP-0867H | Recombinant Human CAMP Protein (Gln31-Ser170), His tagged | +Inquiry |
CAMP-2795HF | Recombinant Full Length Human CAMP Protein, GST-tagged | +Inquiry |
Camp-909M | Recombinant Mouse Camp Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMP-7871HCL | Recombinant Human CAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMP Products
Required fields are marked with *
My Review for All CAMP Products
Required fields are marked with *