Recombinant Human CAMP protein, His-SUMO & Myc-tagged
| Cat.No. : | CAMP-2627H |
| Product Overview : | Recombinant Human CAMP protein(P49913)(132-170aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 132-170aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.7 kDa |
| AA Sequence : | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CAMP cathelicidin antimicrobial peptide [ Homo sapiens ] |
| Official Symbol | CAMP |
| Synonyms | CAMP; cathelicidin antimicrobial peptide; CAP18; FALL 39; FALL39; LL37; 18 kDa cationic antimicrobial protein; CRAMP; HSD26; CAP-18; FALL-39; |
| Gene ID | 820 |
| mRNA Refseq | NM_004345 |
| Protein Refseq | NP_004336 |
| MIM | 600474 |
| UniProt ID | P49913 |
| ◆ Recombinant Proteins | ||
| CAMP-0346H | Recombinant Human CAMP Protein, GST-Tagged | +Inquiry |
| CAMP-2200C | Recombinant Chicken CAMP | +Inquiry |
| CAMP-619R | Recombinant Rhesus monkey CAMP Protein, His-tagged | +Inquiry |
| Camp-662R | Recombinant Rat Camp Protein, His/GST-tagged | +Inquiry |
| CAMP-2677M | Recombinant Mouse CAMP Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAMP-7871HCL | Recombinant Human CAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMP Products
Required fields are marked with *
My Review for All CAMP Products
Required fields are marked with *
