Recombinant Human CAMP protein, His-SUMO & Myc-tagged

Cat.No. : CAMP-2627H
Product Overview : Recombinant Human CAMP protein(P49913)(132-170aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 132-170aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 24.7 kDa
AA Sequence : FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CAMP cathelicidin antimicrobial peptide [ Homo sapiens ]
Official Symbol CAMP
Synonyms CAMP; cathelicidin antimicrobial peptide; CAP18; FALL 39; FALL39; LL37; 18 kDa cationic antimicrobial protein; CRAMP; HSD26; CAP-18; FALL-39;
Gene ID 820
mRNA Refseq NM_004345
Protein Refseq NP_004336
MIM 600474
UniProt ID P49913

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAMP Products

Required fields are marked with *

My Review for All CAMP Products

Required fields are marked with *

0
cart-icon