Recombinant Human CAND1 protein, His-tagged
Cat.No. : | CAND1-18H |
Product Overview : | Recombinant Human CAND1 protein(Q86VP6)(Ser281-Thr450), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ser281-Thr450 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKT |
Gene Name | CAND1 cullin-associated and neddylation-dissociated 1 [ Homo sapiens ] |
Official Symbol | CAND1 |
Synonyms | CAND1; cullin-associated and neddylation-dissociated 1; cullin-associated NEDD8-dissociated protein 1; DKFZp434M1414; KIAA0829; TBP interacting protein; TIP120; TIP120A; p120 CAND1; TBP-interacting protein 120A; TBP-interacting protein of 120 kDa A; cullin-associated and neddylation-dissociated protein 1; FLJ10114; FLJ10929; FLJ38691; FLJ90441; |
Gene ID | 55832 |
mRNA Refseq | NM_018448 |
Protein Refseq | NP_060918 |
MIM | 607727 |
UniProt ID | Q86VP6 |
◆ Recombinant Proteins | ||
CAND1-775R | Recombinant Rat CAND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAND1-1207M | Recombinant Mouse CAND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAND1-2683M | Recombinant Mouse CAND1 Protein | +Inquiry |
CAND1-12650Z | Recombinant Zebrafish CAND1 | +Inquiry |
CAND1-18H | Recombinant Human CAND1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAND1-7869HCL | Recombinant Human CAND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAND1 Products
Required fields are marked with *
My Review for All CAND1 Products
Required fields are marked with *