Recombinant Human CAND1 protein, His-tagged

• Cat.No.: CAND1-18H
• Product Overview: Recombinant Human CAND1 protein(Q86VP6)(Ser281-Thr450), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Ser281-Thr450
• Tag: C-His
• Form: Phosphate buffered saline
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKT

Gene Information

• Gene Name: CAND1 cullin-associated and neddylation-dissociated 1 [ Homo sapiens ]
• Official Symbol: CAND1
• Synonyms: CAND1; cullin-associated and neddylation-dissociated 1; cullin-associated NEDD8-dissociated protein 1; DKFZp434M1414; KIAA0829; TBP interacting protein; TIP120; TIP120A; p120 CAND1; TBP-interacting protein 120A; TBP-interacting protein of 120 kDa A; cullin-associated and neddylation-dissociated protein 1; FLJ10114; FLJ10929; FLJ38691; FLJ90441
• Gene ID: 55832
• mRNA Refseq: NM_018448
• Protein Refseq: NP_060918
• MIM: 607727
• UniProt ID: Q86VP6