Recombinant Human CAND1 protein, His-tagged

Cat.No. : CAND1-18H
Product Overview : Recombinant Human CAND1 protein(Q86VP6)(Ser281-Thr450), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ser281-Thr450
Tag : C-His
Form : Phosphate buffered saline
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKT
Gene Name CAND1 cullin-associated and neddylation-dissociated 1 [ Homo sapiens ]
Official Symbol CAND1
Synonyms CAND1; cullin-associated and neddylation-dissociated 1; cullin-associated NEDD8-dissociated protein 1; DKFZp434M1414; KIAA0829; TBP interacting protein; TIP120; TIP120A; p120 CAND1; TBP-interacting protein 120A; TBP-interacting protein of 120 kDa A; cullin-associated and neddylation-dissociated protein 1; FLJ10114; FLJ10929; FLJ38691; FLJ90441;
Gene ID 55832
mRNA Refseq NM_018448
Protein Refseq NP_060918
MIM 607727
UniProt ID Q86VP6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAND1 Products

Required fields are marked with *

My Review for All CAND1 Products

Required fields are marked with *

0
cart-icon