Recombinant Human CANX protein, His-tagged
| Cat.No. : | CANX-3377H |
| Product Overview : | Recombinant Human CANX protein(1-273 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 18, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-273 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CANX calnexin [ Homo sapiens ] |
| Official Symbol | CANX |
| Synonyms | CANX; calnexin; CNX; IP90; major histocompatibility complex class I antigen binding protein p88; P90; major histocompatibility complex class I antigen-binding protein p88; FLJ26570; |
| Gene ID | 821 |
| mRNA Refseq | NM_001024649 |
| Protein Refseq | NP_001019820 |
| MIM | 114217 |
| UniProt ID | P27824 |
| ◆ Recombinant Proteins | ||
| CANX-207H | Recombinant Human CANX Protein, His-tagged | +Inquiry |
| CANX-1394H | Recombinant Human Calnexin | +Inquiry |
| CANX-1114R | Recombinant Rat CANX Protein | +Inquiry |
| CANX-27552TH | Recombinant Human CANX | +Inquiry |
| CANX-0350H | Recombinant Human CANX Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CANX-081HKCL | Human CANX Knockdown Cell Lysate | +Inquiry |
| CANX-1347HCL | Recombinant Human CANX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CANX Products
Required fields are marked with *
My Review for All CANX Products
Required fields are marked with *
