Recombinant Human CAPN13 Protein, GST-tagged
Cat.No. : | CAPN13-309H |
Product Overview : | Recombinant Human CAPN13(570 a.a. - 668 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 570 a.a. - 668 a.a. |
Description : | The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes a member of the calpain large subunit family. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LVHYQHVFQKVQTSPGVLLSSDLWKAIENTDFLRGIFISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMY |
Applications : | Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CAPN13 calpain 13 [ Homo sapiens ] |
Official Symbol | CAPN13 |
Synonyms | CANP 13; calcium-activated neutral proteinase 13 |
Gene ID | 92291 |
mRNA Refseq | NM_144575 |
Protein Refseq | NP_653176 |
MIM | 610228 |
UniProt ID | Q6MZZ7 |
◆ Recombinant Proteins | ||
Capn13-1952M | Recombinant Mouse Capn13 Protein, Myc/DDK-tagged | +Inquiry |
CAPN13-1878HFL | Recombinant Full Length Human CAPN13 Protein, C-Flag-tagged | +Inquiry |
CAPN13-1215M | Recombinant Mouse CAPN13 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPN13-308H | Recombinant Human CAPN13 Protein, MYC/DDK-tagged | +Inquiry |
CAPN13-2693M | Recombinant Mouse CAPN13 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPN13-7864HCL | Recombinant Human CAPN13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAPN13 Products
Required fields are marked with *
My Review for All CAPN13 Products
Required fields are marked with *
0
Inquiry Basket