Recombinant Human CAPN13 Protein, GST-tagged

Cat.No. : CAPN13-309H
Product Overview : Recombinant Human CAPN13(570 a.a. - 668 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 570 a.a. - 668 a.a.
Description : The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes a member of the calpain large subunit family.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : LVHYQHVFQKVQTSPGVLLSSDLWKAIENTDFLRGIFISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMY
Applications : Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CAPN13 calpain 13 [ Homo sapiens ]
Official Symbol CAPN13
Synonyms CANP 13; calcium-activated neutral proteinase 13
Gene ID 92291
mRNA Refseq NM_144575
Protein Refseq NP_653176
MIM 610228
UniProt ID Q6MZZ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAPN13 Products

Required fields are marked with *

My Review for All CAPN13 Products

Required fields are marked with *

0
cart-icon