Recombinant Human CAPN15 Protein, GST-tagged

Cat.No. : CAPN15-38H
Product Overview : Recombinant Human CAPN15(993 a.a. - 1086 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 993 a.a. - 1086 a.a.
Description : This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.08 kDa
AA Sequence : HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
Applications : Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CAPN15 calpain 15 [ Homo sapiens ]
Official Symbol CAPN15
Synonyms SOLH
Gene ID 6650
mRNA Refseq NM_005632
Protein Refseq NP_005623
MIM 603267
UniProt ID O75808

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAPN15 Products

Required fields are marked with *

My Review for All CAPN15 Products

Required fields are marked with *

0
cart-icon
0
compare icon