Recombinant Human CAPN3

• Cat.No.: CAPN3-27402TH
• Product Overview: Recombinant fragment of Human Calpain 3 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Isoform I is skeletal muscle specific.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
• Sequence Similarities: Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 4 EF-hand domains.

Gene Information

• Gene Name: CAPN3 calpain 3, (p94) [ Homo sapiens ]
• Official Symbol: CAPN3
• Synonyms: CAPN3; calpain 3, (p94); LGMD2, LGMD2A; calpain-3; CANP3; nCL 1; p94
• Gene ID: 825
• mRNA Refseq: NM_000070
• Protein Refseq: NP_000061
• MIM: 114240
• Uniprot ID: P20807
• Chromosome Location: 15q15.1
• Pathway: Integrin-mediated cell adhesion, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem
• Function: calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; signal transducer activity