Recombinant Human CARD10 Protein, GST-Tagged

• Cat.No.: CARD10-0390H
• Product Overview: Human CARD10 partial ORF (NP_055365, 566 a.a. - 655 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The caspase recruitment domain (CARD) is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. Like several other CARD proteins, CARD10 belongs to the membrane-associated guanylate kinase (MAGUK) family and activates NF-kappa-B (NFKB; see MIM 164011) through BCL10 (MIM 603517) (Wang et al., 2001 [PubMed 11259443]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 35.64 kDa
• AA Sequence: LSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGRSPPGGPEPQDKGPDGLSFYGDRWSGAVVRRVLSGPGSARMEPREQRVEAA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CARD10 caspase recruitment domain family, member 10 [ Homo sapiens ]
• Official Symbol: CARD10
• Synonyms: CARD10; caspase recruitment domain family, member 10; caspase recruitment domain-containing protein 10; BIMP1; CARMA3; carma 3; CARD-containing MAGUK 3 protein; CARD-containing MAGUK protein 3; Bcl10 binding protein and activator of NFKB; MGC142219
• Gene ID: 29775
• mRNA Refseq: NM_014550
• Protein Refseq: NP_055365
• MIM: 607209
• UniProt ID: Q9BWT7