Recombinant Human CARD10 Protein, GST-Tagged
Cat.No. : | CARD10-0390H |
Product Overview : | Human CARD10 partial ORF (NP_055365, 566 a.a. - 655 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The caspase recruitment domain (CARD) is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. Like several other CARD proteins, CARD10 belongs to the membrane-associated guanylate kinase (MAGUK) family and activates NF-kappa-B (NFKB; see MIM 164011) through BCL10 (MIM 603517) (Wang et al., 2001 [PubMed 11259443]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | LSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGRSPPGGPEPQDKGPDGLSFYGDRWSGAVVRRVLSGPGSARMEPREQRVEAA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CARD10 caspase recruitment domain family, member 10 [ Homo sapiens ] |
Official Symbol | CARD10 |
Synonyms | CARD10; caspase recruitment domain family, member 10; caspase recruitment domain-containing protein 10; BIMP1; CARMA3; carma 3; CARD-containing MAGUK 3 protein; CARD-containing MAGUK protein 3; Bcl10 binding protein and activator of NFKB; MGC142219; |
Gene ID | 29775 |
mRNA Refseq | NM_014550 |
Protein Refseq | NP_055365 |
MIM | 607209 |
UniProt ID | Q9BWT7 |
◆ Recombinant Proteins | ||
Card10-286M | Recombinant Mouse Card10 Protein, MYC/DDK-tagged | +Inquiry |
CARD10-0390H | Recombinant Human CARD10 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARD10-7851HCL | Recombinant Human CARD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARD10 Products
Required fields are marked with *
My Review for All CARD10 Products
Required fields are marked with *