Recombinant Human CARD19 Protein, GST-Tagged

Cat.No. : CARD19 -0218H
Product Overview : Human CARD19 full-length ORF (NP_115686.3, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CARD19 (Caspase Recruitment Domain Family Member 19) is a Protein Coding gene.
Molecular Mass : 47 kDa
AA Sequence : MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CARD19 caspase recruitment domain family member 19 [ Homo sapiens (human) ]
Official Symbol CARD19
Synonyms CARD19; caspase recruitment domain family member 19; C9ORF89; chromosome 9 open reading frame 89; bcl10-interacting CARD protein; bA370F5.1; Bcl10 interacting protein with CARD; BinCARD; MGC11115; Bcl10-interacting protein with CARD; MGC110898;
Gene ID 84270
mRNA Refseq NM_032310
Protein Refseq NP_115686
UniProt ID Q96LW7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CARD19 Products

Required fields are marked with *

My Review for All CARD19 Products

Required fields are marked with *

0
cart-icon
0
compare icon