Recombinant Human CARS2 Protein, GST-Tagged

Cat.No. : CARS2-0405H
Product Overview : Human CARS2 full-length ORF (BAB13978.1, 1 a.a. - 564 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a putative member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of cysteine to tRNA molecules. A splice-site mutation in this gene has been associated with a novel progressive myoclonic epilepsy disease with similar symptoms to MERRF syndrome. [provided by RefSeq, Mar 2015]
Molecular Mass : 88.6 kDa
AA Sequence : MLRTTRGPGLGPPLLQAALGLGRAGWHWPAGRAASGGRGRAWLQPTGRETGVQVYNSLTGRKEPLIVAHAEAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTKVFGCSIVMVMGITDVDDKIIKRANEMNISPASLASLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGIIARGNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALWKAAKPQEVFWASPWGPGRPGWHIECSAIASMVFGSQLDIHSGGIDLAFPHHENEIAQCEVFHQCEQWGNYFLHSGHLHAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYRSAIDYSDSAMLQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVVDAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQRTKDQKSAG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CARS2 cysteinyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ]
Official Symbol CARS2
Synonyms CARS2; cysteinyl-tRNA synthetase 2, mitochondrial (putative); probable cysteine--tRNA ligase, mitochondrial; cysteine tRNA ligase 2; mitochondrial (putative); FLJ12118; cysRS; cysteine--tRNA ligase; cysteine tRNA ligase 2, mitochondrial (putative); probable cysteinyl-tRNA synthetase, mitochondrial; FLJ42514; DKFZp667A2315; DKFZp686G08243;
Gene ID 79587
mRNA Refseq NM_024537
Protein Refseq NP_078813
MIM 612800
UniProt ID Q9HA77

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CARS2 Products

Required fields are marked with *

My Review for All CARS2 Products

Required fields are marked with *

0
cart-icon