Recombinant Human CARS2 Protein, GST-Tagged
| Cat.No. : | CARS2-0405H |
| Product Overview : | Human CARS2 full-length ORF (BAB13978.1, 1 a.a. - 564 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a putative member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of cysteine to tRNA molecules. A splice-site mutation in this gene has been associated with a novel progressive myoclonic epilepsy disease with similar symptoms to MERRF syndrome. [provided by RefSeq, Mar 2015] |
| Molecular Mass : | 88.6 kDa |
| AA Sequence : | MLRTTRGPGLGPPLLQAALGLGRAGWHWPAGRAASGGRGRAWLQPTGRETGVQVYNSLTGRKEPLIVAHAEAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTKVFGCSIVMVMGITDVDDKIIKRANEMNISPASLASLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGIIARGNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALWKAAKPQEVFWASPWGPGRPGWHIECSAIASMVFGSQLDIHSGGIDLAFPHHENEIAQCEVFHQCEQWGNYFLHSGHLHAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYRSAIDYSDSAMLQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVVDAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQRTKDQKSAG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CARS2 cysteinyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ] |
| Official Symbol | CARS2 |
| Synonyms | CARS2; cysteinyl-tRNA synthetase 2, mitochondrial (putative); probable cysteine--tRNA ligase, mitochondrial; cysteine tRNA ligase 2; mitochondrial (putative); FLJ12118; cysRS; cysteine--tRNA ligase; cysteine tRNA ligase 2, mitochondrial (putative); probable cysteinyl-tRNA synthetase, mitochondrial; FLJ42514; DKFZp667A2315; DKFZp686G08243; |
| Gene ID | 79587 |
| mRNA Refseq | NM_024537 |
| Protein Refseq | NP_078813 |
| MIM | 612800 |
| UniProt ID | Q9HA77 |
| ◆ Recombinant Proteins | ||
| Cars2-616M | Recombinant Mouse Cars2 Protein, His-tagged | +Inquiry |
| CARS2-617H | Recombinant Human CARS2 Protein, His-tagged | +Inquiry |
| Cars2-618R | Recombinant Rat Cars2 Protein, His-tagged | +Inquiry |
| CARS2-2898HF | Recombinant Full Length Human CARS2 Protein, GST-tagged | +Inquiry |
| CARS2-0405H | Recombinant Human CARS2 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARS2 Products
Required fields are marked with *
My Review for All CARS2 Products
Required fields are marked with *
