Recombinant Human CARTPT, His-tagged

Cat.No. : CARTPT-53H
Product Overview : Recombinant Human Cocaine- and Amphetamine-Regulated Transcript Protein/CARTPT is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln28-Leu116) of Human CARTPT fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 28-116 a.a.
Description : Cocaine- and Amphetamine-Regulated Transcript Protein (CARTPT) is a secreted protein that belongs to the CART family. CARTPT is detected in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus. CARTPT is processed by prohormone/proprotein convertases to produce smaller, biologically active peptides. CARTPT is a satiety factor closely associated with the actions of leptin and neuropeptide Y. This anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. CARTPT promotes neuronal development and survival in vitro.
AA Sequence : QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRK GARIGKLCDCPRGTSCNSFLLKCLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name CARTPT CART prepropeptide [ Homo sapiens ]
Official Symbol CARTPT
Synonyms CARTPT; CART prepropeptide; cocaine- and amphetamine-regulated transcript protein; CART; cocaine and amphetamine regulated transcript;
Gene ID 9607
mRNA Refseq NM_004291
Protein Refseq NP_004282
MIM 602606
UniProt ID Q16568
Chromosome Location 5q13.2
Function molecular_function; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CARTPT Products

Required fields are marked with *

My Review for All CARTPT Products

Required fields are marked with *

0
cart-icon