Recombinant Human CARTPT, His-tagged
Cat.No. : | CARTPT-53H |
Product Overview : | Recombinant Human Cocaine- and Amphetamine-Regulated Transcript Protein/CARTPT is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln28-Leu116) of Human CARTPT fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 28-116 a.a. |
Description : | Cocaine- and Amphetamine-Regulated Transcript Protein (CARTPT) is a secreted protein that belongs to the CART family. CARTPT is detected in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus. CARTPT is processed by prohormone/proprotein convertases to produce smaller, biologically active peptides. CARTPT is a satiety factor closely associated with the actions of leptin and neuropeptide Y. This anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. CARTPT promotes neuronal development and survival in vitro. |
AA Sequence : | QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRK GARIGKLCDCPRGTSCNSFLLKCLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CARTPT CART prepropeptide [ Homo sapiens ] |
Official Symbol | CARTPT |
Synonyms | CARTPT; CART prepropeptide; cocaine- and amphetamine-regulated transcript protein; CART; cocaine and amphetamine regulated transcript; |
Gene ID | 9607 |
mRNA Refseq | NM_004291 |
Protein Refseq | NP_004282 |
MIM | 602606 |
UniProt ID | Q16568 |
Chromosome Location | 5q13.2 |
Function | molecular_function; protein binding; |
◆ Recombinant Proteins | ||
CARTPT-458R | Recombinant Rhesus Macaque CARTPT Protein, His (Fc)-Avi-tagged | +Inquiry |
CARTPT-233H | Recombinant Human CARTPT, Fc tagged | +Inquiry |
CARTPT-0850H | Recombinant Human CARTPT Protein (Gln28-Leu116), C-His tagged | +Inquiry |
CARTPT-1726H | Recombinant Human CARTPT protein, His-tagged | +Inquiry |
CARTPT-630R | Recombinant Rhesus monkey CARTPT Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARTPT-911HCL | Recombinant Human CARTPT cell lysate | +Inquiry |
CARTPT-001HCL | Recombinant Human CARTPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARTPT Products
Required fields are marked with *
My Review for All CARTPT Products
Required fields are marked with *