Recombinant Human CASP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CASP1-3737H |
Product Overview : | CASP1 MS Standard C13 and N15-labeled recombinant protein (NP_150636) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. |
Molecular Mass : | 29.6 kDa |
AA Sequence : | MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CASP1 caspase 1 [ Homo sapiens (human) ] |
Official Symbol | CASP1 |
Synonyms | CASP1; caspase 1, apoptosis-related cysteine peptidase; caspase 1, apoptosis related cysteine peptidase (interleukin 1, beta, convertase), caspase 1, apoptosis related cysteine protease (interleukin 1, beta, convertase), IL1BC; caspase-1; caspase 1; ICE; interleukin 1; beta; convertase; IL1B-convertase; CASP1 nirs variant 1; IL-1 beta-converting enzyme; interleukin 1, beta, convertase; interleukin 1-B converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase); P45; IL1BC; |
Gene ID | 834 |
mRNA Refseq | NM_033294 |
Protein Refseq | NP_150636 |
MIM | 147678 |
UniProt ID | P29466 |
◆ Recombinant Proteins | ||
CASP1-174H | Recombinant Human CASP1 Protein, His-tagged | +Inquiry |
Casp1-577R | Recombinant Rat Casp1 protein, His-tagged | +Inquiry |
CASP1-1639H | Recombinant Human Caspase 1, Apoptosis-Related Cysteine Peptidase (interleukin 1, beta, convertase), His-tagged | +Inquiry |
CASP1-0411H | Recombinant Human CASP1 Protein, GST-Tagged | +Inquiry |
CASP1-2634H | Recombinant Human CASP1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CASP1-596H | Active Recombinant Human CASP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP1-7841HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
CASP1-7840HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP1 Products
Required fields are marked with *
My Review for All CASP1 Products
Required fields are marked with *