Recombinant Human CASP2 protein, His-SUMO-tagged
| Cat.No. : | CASP2-2636H |
| Product Overview : | Recombinant Human CASP2 protein(P42575)(2-452aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-452aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 66.6 kDa |
| AA Sequence : | AAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CASP2 caspase 2, apoptosis-related cysteine peptidase [ Homo sapiens ] |
| Official Symbol | CASP2 |
| Synonyms | CASP2; caspase 2, apoptosis-related cysteine peptidase; NEDD2, neural precursor cell expressed, developmentally down regulated 2; caspase-2; ICH1; PPP1R57; protein phosphatase 1; regulatory subunit 57; protease ICH-1; protein phosphatase 1, regulatory subunit 57; neural precursor cell expressed developmentally down-regulated protein 2; NEDD2; CASP-2; NEDD-2; |
| Gene ID | 835 |
| mRNA Refseq | NM_001224 |
| Protein Refseq | NP_001215 |
| MIM | 600639 |
| UniProt ID | P42575 |
| ◆ Recombinant Proteins | ||
| CASP2-0419H | Recombinant Human CASP2 Protein, GST-Tagged | +Inquiry |
| CASP2-195H | Recombinant Human CASP2, His-tagged | +Inquiry |
| CASP2-2593H | Recombinant Human CASP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CASP2-2926HF | Recombinant Full Length Human CASP2 Protein, GST-tagged | +Inquiry |
| CASP2-0858H | Recombinant Human CASP2 Protein (Gly334-Thr452), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CASP2-285HCL | Recombinant Human CASP2 cell lysate | +Inquiry |
| CASP2-330HKCL | Human CASP2 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP2 Products
Required fields are marked with *
My Review for All CASP2 Products
Required fields are marked with *



