Recombinant Human CASP2 protein, His-SUMO-tagged
Cat.No. : | CASP2-2636H |
Product Overview : | Recombinant Human CASP2 protein(P42575)(2-452aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-452aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 66.6 kDa |
AA Sequence : | AAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CASP2 caspase 2, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP2 |
Synonyms | CASP2; caspase 2, apoptosis-related cysteine peptidase; NEDD2, neural precursor cell expressed, developmentally down regulated 2; caspase-2; ICH1; PPP1R57; protein phosphatase 1; regulatory subunit 57; protease ICH-1; protein phosphatase 1, regulatory subunit 57; neural precursor cell expressed developmentally down-regulated protein 2; NEDD2; CASP-2; NEDD-2; |
Gene ID | 835 |
mRNA Refseq | NM_001224 |
Protein Refseq | NP_001215 |
MIM | 600639 |
UniProt ID | P42575 |
◆ Recombinant Proteins | ||
CASP2-1144R | Recombinant Rat CASP2 Protein | +Inquiry |
RFL9758AF | Recombinant Full Length Arabidopsis Thaliana Casparian Strip Membrane Protein 2(Casp2) Protein, His-Tagged | +Inquiry |
CASP2-0858H | Recombinant Human CASP2 Protein (Gly334-Thr452), His tagged | +Inquiry |
CASP2-1243M | Recombinant Mouse CASP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASP2-2715H | Recombinant Human CASP2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP2-285HCL | Recombinant Human CASP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP2 Products
Required fields are marked with *
My Review for All CASP2 Products
Required fields are marked with *