Recombinant Human CASQ2 Protein, GST-Tagged
Cat.No. : | CASQ2-0436H |
Product Overview : | Human CASQ2 full-length ORF (AAH22288, 20 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. The protein is a calcium binding protein that stores calcium for muscle function. Mutations in this gene cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 67.54 kDa |
AA Sequence : | EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CASQ2 calsequestrin 2 (cardiac muscle) [ Homo sapiens ] |
Official Symbol | CASQ2 |
Synonyms | CASQ2; calsequestrin 2 (cardiac muscle); calsequestrin-2; PDIB2; calsequestrin, cardiac muscle isoform; calsequestrin 2, fast-twitch, cardiac muscle; FLJ26321; FLJ93514; |
Gene ID | 845 |
mRNA Refseq | NM_001232 |
Protein Refseq | NP_001223 |
MIM | 114251 |
UniProt ID | O14958 |
◆ Recombinant Proteins | ||
CASQ2-0436H | Recombinant Human CASQ2 Protein, GST-Tagged | +Inquiry |
Casq2-775M | Recombinant Mouse Casq2 Protein, MYC/DDK-tagged | +Inquiry |
CASQ2-301241H | Recombinant Human CASQ2 protein, GST-tagged | +Inquiry |
CASQ2-6095C | Recombinant Chicken CASQ2 | +Inquiry |
CASQ2-2760M | Recombinant Mouse CASQ2 Protein | +Inquiry |
◆ Native Proteins | ||
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASQ2-7826HCL | Recombinant Human CASQ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASQ2 Products
Required fields are marked with *
My Review for All CASQ2 Products
Required fields are marked with *