Recombinant Human CASR Protein, GST-Tagged
Cat.No. : | CASR-0439H |
Product Overview : | Human CASR partial ORF (NP_000379, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a G protein-coupled receptor that is expressed in the parathyroid hormone (PTH)-producing chief cells of the parathyroid gland, and the cells lining the kidney tubule. It senses small changes in circulating calcium concentration and couples this information to intracellular signaling pathways that modify PTH secretion or renal cation handling, thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene cause familial hypocalciuric hypercalcemia, familial, isolated hypoparathyroidism, and neonatal severe primary hyperparathyroidism. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CASR calcium-sensing receptor [ Homo sapiens ] |
Official Symbol | CASR |
Synonyms | CASR; calcium-sensing receptor; HHC, HHC1, hypocalciuric hypercalcemia 1; extracellular calcium-sensing receptor; FHH; GPRC2A; NSHPT; severe neonatal hyperparathyroidism; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; CAR; FIH; HHC; EIG8; HHC1; PCAR1; MGC138441; |
Gene ID | 846 |
mRNA Refseq | NM_000388 |
Protein Refseq | NP_000379 |
MIM | 601199 |
UniProt ID | P41180 |
◆ Recombinant Proteins | ||
CASR-0439H | Recombinant Human CASR Protein, GST-Tagged | +Inquiry |
CASR-1036HFL | Recombinant Human CASR protein, His&Flag-tagged | +Inquiry |
CASR-385H | Recombinant Human CASR Protein (20-612 aa), GST-tagged | +Inquiry |
CASR-27796TH | Recombinant Human CASR | +Inquiry |
CASR-2757H | Recombinant Human CASR protein(871-1070 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASR-7825HCL | Recombinant Human CASR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASR Products
Required fields are marked with *
My Review for All CASR Products
Required fields are marked with *
0
Inquiry Basket