Recombinant Human CASR Protein, GST-Tagged

Cat.No. : CASR-0439H
Product Overview : Human CASR partial ORF (NP_000379, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a G protein-coupled receptor that is expressed in the parathyroid hormone (PTH)-producing chief cells of the parathyroid gland, and the cells lining the kidney tubule. It senses small changes in circulating calcium concentration and couples this information to intracellular signaling pathways that modify PTH secretion or renal cation handling, thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene cause familial hypocalciuric hypercalcemia, familial, isolated hypoparathyroidism, and neonatal severe primary hyperparathyroidism. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CASR calcium-sensing receptor [ Homo sapiens ]
Official Symbol CASR
Synonyms CASR; calcium-sensing receptor; HHC, HHC1, hypocalciuric hypercalcemia 1; extracellular calcium-sensing receptor; FHH; GPRC2A; NSHPT; severe neonatal hyperparathyroidism; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; CAR; FIH; HHC; EIG8; HHC1; PCAR1; MGC138441;
Gene ID 846
mRNA Refseq NM_000388
Protein Refseq NP_000379
MIM 601199
UniProt ID P41180

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASR Products

Required fields are marked with *

My Review for All CASR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon