Recombinant Human CATSPER2 protein, His-tagged
Cat.No. : | CATSPER2-2733H |
Product Overview : | Recombinant Human CATSPER2 protein(1 - 110 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 110 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLECPLF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CATSPER2 cation channel, sperm associated 2 [ Homo sapiens ] |
Official Symbol | CATSPER2 |
Synonyms | CATSPER2; cation channel, sperm associated 2; cation channel sperm-associated protein 2; sperm ion channel; MGC33346; |
Gene ID | 117155 |
mRNA Refseq | NM_054020 |
Protein Refseq | NP_473361 |
MIM | 607249 |
UniProt ID | Q96P56 |
◆ Recombinant Proteins | ||
RFL34640MF | Recombinant Full Length Mouse Cation Channel Sperm-Associated Protein 2(Catsper2) Protein, His-Tagged | +Inquiry |
CATSPER2-2767M | Recombinant Mouse CATSPER2 Protein | +Inquiry |
CATSPER2-2733H | Recombinant Human CATSPER2 protein, His-tagged | +Inquiry |
RFL35112RF | Recombinant Full Length Rat Cation Channel Sperm-Associated Protein 2(Catsper2) Protein, His-Tagged | +Inquiry |
CATSPER2-1151R | Recombinant Rat CATSPER2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CATSPER2 Products
Required fields are marked with *
My Review for All CATSPER2 Products
Required fields are marked with *