Recombinant Human CAV1 protein, GST-tagged
| Cat.No. : | CAV1-26608TH |
| Product Overview : | Recombinant Human CAV1(1 a.a. - 178 a.a) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-178 a.a. |
| Description : | The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 45.21 kDa |
| AA Sequence : | MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEP EGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI YVHTVCDPLFEAVGKIFSNVRINLQKEI |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CAV1 caveolin 1, caveolae protein, 22kDa [ Homo sapiens ] |
| Official Symbol | CAV1 |
| Synonyms | CAV1; caveolin 1, caveolae protein, 22kDa; CAV, caveolin 1, caveolae protein, 22kD; caveolin-1; cell growth-inhibiting protein 32; CGL3; BSCL3; VIP21; MSTP085; |
| Gene ID | 857 |
| mRNA Refseq | NM_001172895 |
| Protein Refseq | NP_001166366 |
| MIM | 601047 |
| UniProt ID | Q03135 |
| Chromosome Location | 7q31 |
| Pathway | ALK1 signaling events, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Basigin interactions, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; |
| Function | cholesterol binding; kinase binding; nitric-oxide synthase binding; patched binding; peptidase activator activity; protein binding; protein complex scaffold; receptor binding; structural molecule activity; syntaxin binding; |
| ◆ Recombinant Proteins | ||
| Cav1-217R | Recombinant Rat Cav1 Protein, His-tagged | +Inquiry |
| CAV1-1258M | Recombinant Mouse CAV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CAV1-0389H | Active Recombinant Human CAV1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
| Cav1-216M | Recombinant Mouse Cav1 Protein, His/GST-tagged | +Inquiry |
| CAV1-215H | Recombinant Human CAV1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAV1-7822HCL | Recombinant Human CAV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAV1 Products
Required fields are marked with *
My Review for All CAV1 Products
Required fields are marked with *
