Recombinant Human CAV3 protein, GST-tagged
Cat.No. : | CAV3-2641H |
Product Overview : | Recombinant Human CAV3 protein(P56539)(1-151aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-151aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.3 kDa |
AA Sequence : | MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CAV3 caveolin 3 [ Homo sapiens ] |
Official Symbol | CAV3 |
Synonyms | CAV3; caveolin 3; caveolin-3; LGMD1C; LQT9; M caveolin; VIP 21; VIP21; M-caveolin; VIP-21; MGC126100; MGC126101; MGC126129; |
Gene ID | 859 |
mRNA Refseq | NM_001234 |
Protein Refseq | NP_001225 |
MIM | 601253 |
UniProt ID | P56539 |
◆ Recombinant Proteins | ||
CAV3-5940C | Recombinant Chicken CAV3 | +Inquiry |
CAV3-633H | Recombinant Human CAV3 Protein, His&GST-tagged | +Inquiry |
CAV3-511H | Recombinant Human CAV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAV3-812R | Recombinant Rat CAV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAV3-1327HFL | Recombinant Full Length Human CAV3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAV3-7819HCL | Recombinant Human CAV3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAV3 Products
Required fields are marked with *
My Review for All CAV3 Products
Required fields are marked with *