Recombinant Human CAV3 protein, GST-tagged
| Cat.No. : | CAV3-2641H |
| Product Overview : | Recombinant Human CAV3 protein(P56539)(1-151aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-151aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.3 kDa |
| AA Sequence : | MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CAV3 caveolin 3 [ Homo sapiens ] |
| Official Symbol | CAV3 |
| Synonyms | CAV3; caveolin 3; caveolin-3; LGMD1C; LQT9; M caveolin; VIP 21; VIP21; M-caveolin; VIP-21; MGC126100; MGC126101; MGC126129; |
| Gene ID | 859 |
| mRNA Refseq | NM_001234 |
| Protein Refseq | NP_001225 |
| MIM | 601253 |
| UniProt ID | P56539 |
| ◆ Recombinant Proteins | ||
| CAV3-2641H | Recombinant Human CAV3 protein, GST-tagged | +Inquiry |
| CAV3-011H | Recombinant Human CAV3 protein, Myc/DDK-tagged | +Inquiry |
| CAV3-464R | Recombinant Rhesus Macaque CAV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CAV3-678HF | Recombinant Full Length Human CAV3 Protein, GST-tagged | +Inquiry |
| CAV3-636R | Recombinant Rhesus monkey CAV3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAV3-7819HCL | Recombinant Human CAV3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAV3 Products
Required fields are marked with *
My Review for All CAV3 Products
Required fields are marked with *
