Recombinant Human CBFB protein, T7/His-tagged

• Cat.No.: CBFB-198H
• Product Overview: Recombinant human CBFβ (182 aa, derived from BC018509) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 1-182 aa
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEFPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNAC RDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMG CLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: CBFB core-binding factor, beta subunit [ Homo sapiens ]
• Official Symbol: CBFB
• Synonyms: CBFB; core-binding factor, beta subunit; core-binding factor subunit beta; PEBP2B; CBF-beta; PEA2-beta; PEBP2-beta; SL3-3 enhancer factor 1 beta subunit; SL3-3 enhancer factor 1 subunit beta; SL3/AKV core-binding factor beta subunit; polyomavirus enhancer-binding protein 2 beta subunit; polyomavirus enhancer binding protein 2, beta subunit
• Gene ID: 865
• mRNA Refseq: NM_001755
• Protein Refseq: NP_001746
• MIM: 121360
• UniProt ID: Q13951
• Chromosome Location: 16q22.1
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem
• Function: protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity