Recombinant Human CBFB protein, T7/His-tagged

Cat.No. : CBFB-198H
Product Overview : Recombinant human CBFβ (182 aa, derived from BC018509) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 1-182 aa
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGEFPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNAC RDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMG CLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name CBFB core-binding factor, beta subunit [ Homo sapiens ]
Official Symbol CBFB
Synonyms CBFB; core-binding factor, beta subunit; core-binding factor subunit beta; PEBP2B; CBF-beta; PEA2-beta; PEBP2-beta; SL3-3 enhancer factor 1 beta subunit; SL3-3 enhancer factor 1 subunit beta; SL3/AKV core-binding factor beta subunit; polyomavirus enhancer-binding protein 2 beta subunit; polyomavirus enhancer binding protein 2, beta subunit;
Gene ID 865
mRNA Refseq NM_001755
Protein Refseq NP_001746
MIM 121360
UniProt ID Q13951
Chromosome Location 16q22.1
Pathway ATF-2 transcription factor network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem;
Function protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBFB Products

Required fields are marked with *

My Review for All CBFB Products

Required fields are marked with *

0
cart-icon
0
compare icon