Recombinant Human CBFB protein, T7/His-tagged
Cat.No. : | CBFB-198H |
Product Overview : | Recombinant human CBFβ (182 aa, derived from BC018509) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 1-182 aa |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGEFPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNAC RDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMG CLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | CBFB core-binding factor, beta subunit [ Homo sapiens ] |
Official Symbol | CBFB |
Synonyms | CBFB; core-binding factor, beta subunit; core-binding factor subunit beta; PEBP2B; CBF-beta; PEA2-beta; PEBP2-beta; SL3-3 enhancer factor 1 beta subunit; SL3-3 enhancer factor 1 subunit beta; SL3/AKV core-binding factor beta subunit; polyomavirus enhancer-binding protein 2 beta subunit; polyomavirus enhancer binding protein 2, beta subunit; |
Gene ID | 865 |
mRNA Refseq | NM_001755 |
Protein Refseq | NP_001746 |
MIM | 121360 |
UniProt ID | Q13951 |
Chromosome Location | 16q22.1 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem; |
Function | protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
◆ Recombinant Proteins | ||
CBFB-1262M | Recombinant Mouse CBFB Protein, His (Fc)-Avi-tagged | +Inquiry |
CBFB-10755H | Recombinant Human CBFB, GST-tagged | +Inquiry |
CBFB-2776H | Recombinant Human Core-binding Factor, Beta Subunit, His-tagged | +Inquiry |
CBFB-2765HF | Recombinant Full Length Human CBFB Protein, GST-tagged | +Inquiry |
CBFB-198H | Recombinant Human CBFB protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBFB-7815HCL | Recombinant Human CBFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBFB Products
Required fields are marked with *
My Review for All CBFB Products
Required fields are marked with *
0
Inquiry Basket